KEGG   Gallus gallus (chicken): 414833Help
Entry
414833            CDS       T01006                                 

Gene name
CYP2C45
Definition
cytochrome P-450 2C45
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    414833 (CYP2C45)
   00590 Arachidonic acid metabolism
    414833 (CYP2C45)
   00591 Linoleic acid metabolism
    414833 (CYP2C45)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    414833 (CYP2C45)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     414833 (CYP2C45)
Cytochrome P450 [BR:gga00199]
 Cytochrome P450, animal type
  CYP2 family
   414833 (CYP2C45)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
6
AA seq 494 aa AA seqDB search
MLLLGAASVVLLVCVACLLSIVQWRKRTGKGKMPEGPTPLPIVGNILEVKPKNLAKTLEK
LAEKYGPVFSVQLGSTPVVVLSGYEAVKEALIDRADEFAARGHMPIGDRANKGLGIIFSN
NEGWLHVRRFALSTLRNFGMGKRSIEERIQEEAEHLLEEITKTKRLPFDPTFKLSCAVSN
VICSIVFGKRYDYKDKKFLSLMNNMNNTFEMMNSRWGQLYQMFSYVLDYLPGPHNNIFKE
IDAVKAFVAEEVKLHQASLDPSAPQDFIDCFLSKMQEEKDNPKSHFHMTNLITSTFDLFI
AGTETTSTTTRYGLLLLLKYPKIQEKVQEEIDRVVGRSRRPCVADRTQMPYTDAVVHEIQ
RFITLIPTSLPHAVTKDIHFRDYIIPKGTTVMPLLSTALYDSKEFPNPTEFNPGHFLNQN
GTFRKSDFFIPFSAGKRICPGEGLARMEIFLLLTAILQNFTLKPVISPEELSITPTLSGT
GNVPPYYQLCAFPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcctgggagcagcgagtgtggtcctcctggtttgtgttgcttgcctgctctcc
atcgtgcaatggagaaaaaggactggaaaggggaagatgcctgagggaccaactcccctt
cccatcgtagggaacatactggaggtgaaaccaaagaatttagccaaaacccttgagaag
ctcgctgagaaatatgggcccgtcttctcagtgcaactgggttcaactccagtagtggtg
ctatctggatatgaggcggtgaaagaagccttgattgatcgtgcggatgagtttgctgcc
agaggacacatgcctatcggggaccgggcaaacaaaggattaggcattattttcagcaac
aacgagggatggttacacgttcggcggtttgctctcagcactctgcgcaactttgggatg
gggaagaggagcattgaagagaggatccaggaggaagctgagcacttgcttgaagagatc
acaaaaacaaagagactgccctttgacccaacattcaagctgagctgcgctgtctccaac
gtcatatgctccattgtctttgggaagcgatatgactataaagacaagaagttcctatct
ctgatgaacaacatgaacaacacatttgagatgatgaactcccgctggggacagttatac
cagatgttctcctacgttctggattatttgcccggcccacataacaatatattcaaagaa
attgatgctgtaaaagcctttgtggcagaagaggtaaagctgcaccaagcctccctggat
cccagcgctccccaggatttcatcgactgcttcctcagcaaaatgcaggaggaaaaagac
aatcccaaatcacacttccacatgacaaacctgataacgtccaccttcgacttgttcatt
gctggaacggagacaacaagcaccaccacacgatacgggcttctgcttcttctcaaatat
cccaagatacaagagaaagttcaagaagagattgaccgggtagtaggacgatcacgaaga
ccttgcgtggctgaccggacccagatgccctacacagacgcagtggtccacgaaatccag
cgcttcatcactctcatccctacgagcctccctcatgctgtgaccaaagacatccacttc
agagactacatcattcccaagggcaccacagtcatgcccctcctcagtactgcactctat
gacagcaaggagtttccaaacccaaccgagtttaatcctggacatttcttgaaccagaat
ggcacctttaggaagagcgacttcttcattcccttctcagcagggaaacgcatttgccct
ggagagggcctggcacgcatggagatattcttactcctgaccgccatcctgcagaacttc
accttgaagcctgtcatcagccctgaggaactcagcatcacccctacactgagtgggaca
ggaaatgttcctccctactaccagctctgtgctttcccccgctga

DBGET integrated database retrieval system