KEGG   Gallus gallus (chicken): 414833Help
Entry
414833            CDS       T01006                                 

Gene name
CYP2C45
Definition
cytochrome P-450 2C45
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:gga00140]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:gga00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:gga00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:gga00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
6
AA seq 494 aa AA seqDB search
MLLLGAASVVLLVCVACLLSIVQWRKRTGKGKMPEGPTPLPIVGNILEVKPKNLAKTLEK
LAEKYGPVFSVQLGSTPVVVLSGYEAVKEALIDRADEFAARGHMPIGDRANKGLGIIFSN
NEGWLHVRRFALSTLRNFGMGKRSIEERIQEEAEHLLEEITKTKRLPFDPTFKLSCAVSN
VICSIVFGKRYDYKDKKFLSLMNNMNNTFEMMNSRWGQLYQMFSYVLDYLPGPHNNIFKE
IDAVKAFVAEEVKLHQASLDPSAPQDFIDCFLSKMQEEKDNPKSHFHMTNLITSTFDLFI
AGTETTSTTTRYGLLLLLKYPKIQEKVQEEIDRVVGRSRRPCVADRTQMPYTDAVVHEIQ
RFITLIPTSLPHAVTKDIHFRDYIIPKGTTVMPLLSTALYDSKEFPNPTEFNPGHFLNQN
GTFRKSDFFIPFSAGKRICPGEGLARMEIFLLLTAILQNFTLKPVISPEELSITPTLSGT
GNVPPYYQLCAFPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcctgggagcagcgagtgtggtcctcctggtttgtgttgcttgcctgctctcc
atcgtgcaatggagaaaaaggactggaaaggggaagatgcctgagggaccaactcccctt
cccatcgtagggaacatactggaggtgaaaccaaagaatttagccaaaacccttgagaag
ctcgctgagaaatatgggcccgtcttctcagtgcaactgggttcaactccagtagtggtg
ctatctggatatgaggcggtgaaagaagccttgattgatcgtgcggatgagtttgctgcc
agaggacacatgcctatcggggaccgggcaaacaaaggattaggcattattttcagcaac
aacgagggatggttacacgttcggcggtttgctctcagcactctgcgcaactttgggatg
gggaagaggagcattgaagagaggatccaggaggaagctgagcacttgcttgaagagatc
acaaaaacaaagagactgccctttgacccaacattcaagctgagctgcgctgtctccaac
gtcatatgctccattgtctttgggaagcgatatgactataaagacaagaagttcctatct
ctgatgaacaacatgaacaacacatttgagatgatgaactcccgctggggacagttatac
cagatgttctcctacgttctggattatttgcccggcccacataacaatatattcaaagaa
attgatgctgtaaaagcctttgtggcagaagaggtaaagctgcaccaagcctccctggat
cccagcgctccccaggatttcatcgactgcttcctcagcaaaatgcaggaggaaaaagac
aatcccaaatcacacttccacatgacaaacctgataacgtccaccttcgacttgttcatt
gctggaacggagacaacaagcaccaccacacgatacgggcttctgcttcttctcaaatat
cccaagatacaagagaaagttcaagaagagattgaccgggtagtaggacgatcacgaaga
ccttgcgtggctgaccggacccagatgccctacacagacgcagtggtccacgaaatccag
cgcttcatcactctcatccctacgagcctccctcatgctgtgaccaaagacatccacttc
agagactacatcattcccaagggcaccacagtcatgcccctcctcagtactgcactctat
gacagcaaggagtttccaaacccaaccgagtttaatcctggacatttcttgaaccagaat
ggcacctttaggaagagcgacttcttcattcccttctcagcagggaaacgcatttgccct
ggagagggcctggcacgcatggagatattcttactcctgaccgccatcctgcagaacttc
accttgaagcctgtcatcagccctgaggaactcagcatcacccctacactgagtgggaca
ggaaatgttcctccctactaccagctctgtgctttcccccgctga

DBGET integrated database retrieval system