KEGG   Gallus gallus (chicken): 414837Help
Entry
414837            CDS       T01006                                 

Gene name
THBS2
Definition
thrombospondin 2
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
gga  Gallus gallus (chicken)
Pathway
Phagosome
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    414837 (THBS2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    414837 (THBS2)
  Cell communication
   04510 Focal adhesion
    414837 (THBS2)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   414837 (THBS2)
  Exosomal proteins of colorectal cancer cells
   414837 (THBS2)
  Exosomal proteins of bladder cancer cells
   414837 (THBS2)
Heparan sulfate/heparin binding proteins [BR:gga00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  414837 (THBS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
3
AA seq 1178 aa AA seqDB search
MLQRSRLLWLAVFITLWVSSDAQDDAKEEENTFDLLQISNINRKTIGAKLFRGPDPAIPA
YRFIRFDHIPPFKPEKLKKIVKLIRQNEGFILSATLRQDRQSRGTILALEGPGISERQFE
IISNGRANTLDLIYWVDGFQNVISLEDVDLADSQWKNLTVQVTGENYNLYVGCDLIDSFI
LEEPFYEQLKAENSRMYVAKGSIRENHFRGLLQNIHLIFDTSIEDVLRKKGCQRSQSTEV
NTINESTEILHLSPAVTTEYVGEKTEKKAEFCDRSCEELGTMFTELTGLRIVVNNLADNL
QKVSEENQIMWELIGPNKTLKNQSVCWQDGRVFADSESWIVDSCTKCTCQDSKIVCHQIT
CPPVSCADPSFIEGECCPVCSHSDDSEEGWSPWSDWTKCSVTCGSGTQMRGRSCDVTRSA
CTGPHIQTRMCSFKKCDHRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPIPQMGGK
NCVGNGRETEKCEKAPCPVNGQWGPWSPWSACTVTCGGGIRERSRLCNSPEPQYGGKPCV
GDTKQHDMCNKRDCPIDGCLSNPCFPGAECNSYPDGSWSCGPCPAGFLGNGTVCEDLDEC
IAVSDVCFKVNQVHRCVNTNPGFHCLPCPPRYKGSQPYGVGLEVAKTEKQVCEPENPCKD
KTHSCHKSAECIYLGHFSDPMYKCECRTGYAGDGRICGEDSDLDGWPNNNLVCAANATYH
CVKDNCPLLPNSGQEDFDKDGKGDACDEDDDNDGVEDDKDNCPLLFNPRQFDYDKDEVGD
RCDNCPYVHNPAQIDTDNNGEGDSCAVDIDGDDIFNERDNCPYVYNTDQSDTDGDGVGDQ
CDNCPLMHNPDQTDADNDLVGDQCDNNEDIDEDGHQNNQDNCPYIPNANQADHDKDGKGD
ACDPDDDNDGIPDDRDNCRLRYNPEQEDSDGDGRGDICKDDFDDDNVPDIFDVCPENNAI
SETDFRKFQMVPLDPKGTAQIDPNWVIRHQGKELVQTANSDPGIAVGYDEFSSVDFSGTF
YVNTDRDDDYAGFVFGYQSSSRFYVLMWKQVTQTYWEDKPTRAYGYSGVSLKVVNSTTGT
GEHLRNALWHTGNTPGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGLIKVLVYEGKQVM
VDSGPIYDTTFAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3537 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagaggagcaggctgttgtggcttgctgtcttcataaccctgtgggtttcctca
gatgctcaggatgatgccaaagaagaggagaatacctttgatttacttcaaatcagtaac
ataaaccgaaagacaattggagcaaaattgtttcggggtccagatcccgctatcccagca
tatcgtttcattcggtttgaccatatacctccatttaaaccagagaagttaaaaaagatt
gttaaactcatacggcaaaatgagggctttatcctttcagccaccctgagacaggacagg
caatctagaggcactatccttgctttagagggtcctggcatcagtgagaggcagtttgag
ataatttccaatggccgagccaacaccctggacctcatttattgggtggatggcttccag
aacgtgatttccctggaagacgtggaccttgctgactcgcagtggaagaacctcaccgtg
caagtaacaggagagaactacaacctctatgttggctgtgaccttattgacagcttcatc
ctggaggagcctttctatgagcaactgaaagcagagaacagcagaatgtatgtggcgaaa
gggtccattcgggagaatcatttcaggggtcttttgcaaaatattcatttaatctttgat
acttcaatagaggatgttctacgtaaaaaaggatgccagaggagccaatcaactgaagtg
aacaccatcaatgagagcactgagattcttcacttgagccctgctgtcacgactgagtat
gtaggtgaaaagacagagaagaaggctgagttctgtgaccgctcttgtgaagagctggga
acaatgttcactgaactcactggcctgcgcattgtggtgaacaatttagctgataacctc
caaaaagtgtctgaagagaaccaaataatgtgggaattgattggccctaacaaaacactc
aagaaccaatcagtttgctggcaggatggccgagtctttgcagatagtgaaagctggatt
gtagatagctgcacaaagtgcacctgccaggactctaaaattgtgtgccatcaaatcacc
tgtccaccagtttcttgtgctgatccgtcctttattgaaggtgaatgctgtccagtctgc
tctcactctgatgatagtgaggaaggctggtcaccctggtcagactggacaaagtgctca
gttacctgtggctctgggactcagatgagaggaaggtcttgtgatgtcaccaggagtgct
tgtacaggcccacacattcagacgaggatgtgcagcttcaagaaatgtgaccatcgcata
cgtcaagatggtggttggagtcactggtctccctggtcctcatgttcagttacctgtgga
gtaggaaatatcacccgcatccgcctctgcaattcccctattccccagatgggtgggaaa
aactgtgtgggaaatggacgtgaaacagagaaatgtgagaaggccccgtgcccagtgaat
ggccagtggggtccttggtctccatggtctgcttgcactgttacctgtggaggaggaatc
cgtgagaggtctcgcctctgtaacagtccagagccacagtatggaggaaagccatgtgtg
ggagataccaagcaacatgatatgtgcaataaaagggattgcccaattgatggttgtttg
tcaaatccttgctttcctggagcagaatgcaacagttacccggatggatcgtggtcatgt
gggccatgcccagcaggtttccttggcaatggtacagtctgtgaggatcttgatgagtgt
atagctgtgtcagatgtttgctttaaggtgaatcaggtccatcgctgtgtgaacacaaat
ccgggtttccattgcttgccatgtcctccgcgttataaaggaagtcagccttacggagta
gggctggaagttgccaagacagagaagcaagtctgtgaacctgagaatccatgcaaagac
aagacacacagctgccataaatctgcagagtgcatttatctgggtcatttcagtgatcct
atgtacaaatgtgaatgtaggacaggttatgctggtgatggacgcatctgtggtgaggat
tcagatttggatggatggccaaataataacttggtttgtgctgctaatgctacgtatcac
tgtgtgaaggataactgccccctcctgcctaactctggccaagaagactttgataaagat
ggcaaaggagatgcctgtgatgaggatgatgacaatgatggtgttgaagatgacaaagac
aattgccctcttctgttcaatcctcgtcagtttgattatgacaaagatgaagttggtgac
cgctgtgataattgcccttatgtgcacaaccccgcacagattgacacagataataatggg
gagggtgattcatgtgctgtggatattgatggagatgacatttttaatgaacgagataat
tgtccttacgtttataatacagatcagagtgatacagatggtgatggagttggtgatcag
tgtgataactgtccgctaatgcataatccagaccagactgatgcagataacgatcttgtt
ggtgaccagtgtgacaacaatgaggacatagatgaagatggccaccagaacaaccaagat
aactgcccttacatccccaatgctaaccaggctgaccatgataaagatggtaaaggggat
gcctgtgatcctgatgatgacaatgatggtattccagatgacagggacaattgtcgcctc
agatacaaccctgagcaggaggactctgatggtgatggcagaggtgatatttgcaaagat
gactttgacgatgacaatgttccagatatttttgatgtatgtcctgaaaacaatgccatc
agtgaaactgatttcagaaagttccagatggtccctctggaccccaagggaacagctcag
attgatcccaactgggttattcgccaccaaggcaaggaactggtgcagactgccaactct
gatcctggaatagctgtaggttatgatgagttcagctctgttgacttcagtggcacattc
tatgttaacacagaccgtgatgatgactatgctggctttgtttttggctaccagtccagc
agccgtttttatgttctgatgtggaagcaggtcactcagacctactgggaggacaaaccc
accagggcttatggctattctggtgtgtcactcaaggtagtgaattcaacaactggtact
ggggaacacttgcgaaatgctctttggcatacaggaaacacccctggacaggtgcgcact
ttatggcatgatcctaagaacattggctggaaagattatactgcatacaggtggcatttg
attcacaggcctaaaacaggactaataaaagttctagtgtatgaagggaagcaagtcatg
gtggattctggaccaatctatgatacaacctttgctggtggacgattaggtctatttgtc
ttctctcaagaaatggtctatttctctgacctcaaatatgaatgcagagatgcttga

DBGET integrated database retrieval system