KEGG   Gallus gallus (chicken): 414854Help
Entry
414854            CDS       T01006                                 

Gene name
CYP19A1, CYPXIX
Definition
(RefSeq) cytochrome P450, family 19, subfamily A, polypeptide 1 (EC:1.14.14.14)
  KO
K07434  
aromatase [EC:1.14.14.14]
Organism
gga  Gallus gallus (chicken)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    414854 (CYP19A1)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     414854 (CYP19A1)
Cytochrome P450 [BR:gga00199]
 Cytochrome P450, animal type
  CYP19 family
   414854 (CYP19A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
10
AA seq 502 aa AA seqDB search
MIPETLNPLNYFTSLVPDLMPVATVPIIILICFLFLIWNHEETSSIPGPGYCMGIGPLIS
HGRFLWMGVGNACNYYNKTYGEFVRVWISGEETFIISKSSSVFHVMKHWNYVSRFGSKLG
LQCIGMYENGIIFNNNPAHWKEIRPFFTKALSGPGLVRMIAICVESTIVHLDKLEEVTTE
VGNVNVLNLMRRIMLDTSNKLFLGVPLDESAIVLKIQNYFDAWQALLLKPDIFFKISWLC
KKYEEAAKDLKGAMEILIEQKRQKLSTVEKLDEHMDFASQLIFAQNRGDLTAENVNQCVL
EMMIAAPDTLSVTLFIMLILIAEHPTVEEKMMREIETVMGDRDVQSDDMPNLKIVENFIY
ESMRYQPVVDLIMRKALQDDVIDGYPVKKGTNIILNIGRMHKLEFFPKPNEFSLENFEKN
VPSRYFQPFGFGPRGCVGKFIAMVMMKAILVTLLRRCRVQTMKGRGLNNIQKNNDLSMHP
IERQPLLEMVFTPRSPNKNQSD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgataccagaaactttgaatccactgaactacttcaccagcctggtaccagacttgatg
ccagttgccacagtgcctatcatcattctcatctgctttctgtttctaatatggaatcat
gaagaaacatcatcaataccagggccaggatactgcatgggaattgggcctctcatttca
catgggagatttctctggatgggagtaggtaatgcctgcaactactacaacaagacatat
ggagaatttgtgagagtttggatcagcggtgaagaaacatttataattagcaaatcctcc
agcgtatttcacgtaatgaaacactggaactatgtttctcgatttgggagcaagcttgga
ttacagtgcattggcatgtatgaaaatgggattatatttaataacaacccagcacactgg
aaggagatccgacccttcttcaccaaagccctgtctggtcctggtcttgtgcgcatgata
gccatttgtgttgaatcaacaattgttcacctggacaaactagaagaagtgaccactgaa
gtaggaaacgtcaatgtgttgaacctcatgagacggattatgcttgacacgtctaacaag
ctctttctaggggtccctttggatgaaagtgccattgtacttaagattcagaactacttt
gatgcttggcaagctcttctattaaagcccgacatattttttaagatttcttggctttgc
aagaagtatgaagaggcagccaaagacttgaaaggagcaatggaaatcttaatagaacag
aaacgacaaaagctttccactgttgaaaagttggatgagcacatggattttgcatctcag
ctgatttttgcacagaacagaggagatctgactgctgagaatgtgaaccagtgtgtgctg
gagatgatgattgctgctcctgatactctgtccgtgacactcttcattatgctaatactg
attgcagagcaccccacagtggaggagaagatgatgagagaaattgaaactgttatgggt
gacagagatgtacagagtgatgacatgccaaacctcaaaattgtggagaattttatttat
gagagcatgagataccagccagttgtggacttaatcatgagaaaagctttacaagatgat
gtaattgatggatatcctgtgaaaaagggaacaaacattattctcaacattggacgcatg
cacaagcttgaattcttcccaaaaccgaatgagttttctcttgaaaactttgagaagaat
gttccatcacgctatttccagccatttggatttggccctcggggctgtgtaggaaagttt
attgccatggtaatgatgaaagcaattctggtgactcttctgagacggtgcagagtacag
acaatgaaaggaagaggacttaacaacatccagaaaaacaatgacttatccatgcaccca
atagaaaggcagcctctgctggagatggtttttacaccaagaagcccaaacaagaatcag
agtgactaa

DBGET integrated database retrieval system