KEGG   Gallus gallus (chicken): 414854Help
Entry
414854            CDS       T01006                                 

Gene name
CYP19A1
Definition
cytochrome P450, family 19, subfamily A, polypeptide 1 (EC:1.14.14.14)
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
gga  Gallus gallus (chicken)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:gga00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
10
AA seq 507 aa AA seqDB search
MIPETLNPLNYFTSLVPDLMPVATVPIIILICFLFLIWNHEETSSIPGPGYCMGIGPLIS
HGRFLWMGVGNACNYYNKTYGEFVRVWISGEETFIISKSSSVFHVMKHWNYVSRFGSKLG
LQCIGMYENGIIFNNNPAHWKEIRPFFTKALSGPGLVRMIAICVESTIVHLDKLEEVTTE
VGNVNVLNLMRRIMLDTSNKLFLGVPLDESAIVLKIQNYFDAWQALLLKPDIFFKISWLC
KKYEEAAKDLKGAMEILIEQKRQKLSTVEKLDEHMDFASQLIFAQNRGDLTAENVNQCVL
EMMIAAPDTLSVTLFIMLILIADDPTVEEKMMREIETVMGDREVQSDDMPNLKIVENFIY
ESMRYQPVVDLIMRKALQDDVIDGYPVKKGTNIILNIGRMHKLEFFPKPNEFSLENFEKN
VPSRYFQPFGFGPRGCVGKFIAMVMMKAILVTLLRRCRVQTMKGRGLNNIQKNNDLSMHP
IERQPLLEMVFTQEAQTRIRVTKVDQH
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgataccagaaactttgaatccactgaactacttcaccagcctggtaccagacttgatg
ccagttgccacagtgcctatcatcattctcatctgctttctgtttctaatatggaatcat
gaagaaacatcatcaataccagggccaggatactgcatgggaattgggcctctcatttca
catgggagatttctctggatgggagtaggtaatgcctgcaactactacaacaagacatat
ggagaatttgtgagagtttggatcagcggtgaagaaacatttataattagcaaatcctcc
agcgtatttcacgtaatgaaacactggaactacgtttctcgatttgggagcaagcttgga
ttacagtgcattggcatgtatgaaaatgggattatatttaataacaacccagcacactgg
aaggagatccgacccttcttcaccaaagccctgtctggtcctggtcttgtgcgcatgata
gccatttgtgttgaatcaacaattgttcacctggacaaactagaagaagtgaccactgaa
gtaggaaacgtcaatgtgttgaacctcatgagacggattatgcttgacacgtctaacaag
ctctttctaggggtccctttggatgaaagtgccattgtacttaagattcagaactacttt
gatgcttggcaagctcttctattaaagcccgacatattttttaagatttcttggctttgc
aagaagtatgaagaggcagccaaagacttgaaaggagcaatggaaatcttaatagaacag
aaacgacaaaagctttccactgttgaaaagttggatgagcacatggattttgcatctcag
ctgatttttgcacagaacagaggagatctgactgctgagaatgtcaaccagtgtgtgctg
gagatgatgattgctgctcctgatactctgtccgtgacactcttcattatgctaatactg
attgcagacgaccccacagtggaggagaagatgatgagagaaattgaaactgttatgggt
gacagagaggtacagagtgatgacatgccaaacctcaaaattgtggagaattttatttat
gagagcatgagataccagccagttgtggacttaatcatgagaaaagctttacaagatgat
gtaattgatggatatcctgtgaaaaagggaacaaacattattctcaacattggacgcatg
cacaagcttgaattcttcccaaaaccgaatgagttttctcttgaaaactttgagaagaat
gttccatcacgctatttccagccatttggatttggccctcggggctgtgtaggaaagttt
attgccatggtaatgatgaaagcaattctggtgactcttctgagacggtgcagagtacag
acaatgaaaggaagaggacttaacaacatccagaaaaacaatgacttatccatgcaccca
atagaaaggcagcctctgctggagatggtttttacacaagaagcccaaacaagaatcaga
gtgactaaagtggatcagcattaa

DBGET integrated database retrieval system