KEGG   Gallus gallus (chicken): 415413Help
Entry
415413            CDS       T01006                                 

Gene name
UNC13C
Definition
unc-13 homolog C (C. elegans)
Orthology
K15293  
protein unc-13
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
10
AA seq 2210 aa AA seqDB search
MVSSCLKSLISSYIYKICKGMFTKKLGNSTKRKESCQSKKEQDLTPTGQIKNPKFSNTLK
STVKKIAKCPSARNLSTEEEEGNREFSLSPTFSYRVAIANGLQKHVFVTNNNNEDLTQDL
SSNDSSYSDSLSEVKSNIKKNEYFSYTMPVRRNRKSLSSLAASDGSSDGERTLHTLKLGA
LRKLRKWKKSQECVSSDSELSTWKKXWGLRSKSLDRTGRHQKSNTLEPGFSSTGCISQTH
DVMEMIFKELQGISQIETELSELRGHVNALKQSIDEISSSVEVVQNEIEQLRTGFVQSRR
ETRDIHDYIKQIGHPGNKASLRFLNVPEERLEKTENIVYKILIEKMGFSEAQSTIKIEFA
QRLGQQRDCPNAKPRPILVYFESSQQRDLLLKKSYKLKGTGIGISTDVFAHDIKEKKERG
LPSSQTYESMDMKIVTVETKTKMHDWESPDSDKDVESDINKNSYAKVSKSALQIKTSTTK
GNAESSDPKDLNRTADNNTFSNRRNYDSQSPEFDNVEKQPKMYYSDMTPLWHLQNDFAAP
KLSRSESDFSKLCQSYSEDFSENQYFSKTNGSSLLSSSDRELWQRRQDDSVNWYGSSQEQ
TFAQDAQQYPEQNEVENTETVDSGLSNGIMCVSRDRSHYSDSQLSLHDDFSPWKDWNQLE
RGADLGLDSSTQEVFVYDMSSPSDQQTDFGKCQSSDLQYDTESYDFTLDGTSPSCAGLDS
ESQSQWTSQYDDYQETNSKSPYQNQNRLPMMYRSQSELPSDDSEEAAPKSWHSRLSIDLS
DKTFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSFIGRFRTLSQSTANESSTTL
DSDVYAEPYCYKAEYEEDLIEPPGENETDYVEVMEQVLAKLENRTNSSETSEQVQEYELG
QPPCGSPYAILPEEQYDGQFNGLVSEEILEVESDMDAHMDAHVEIREDENQNVQEMLTEI
PKKKRIRPSFKEAALKAYKKQMNDLEDKILSGDSGSVDEKARIVSGSSLDTSKLYAIQAF
SGSGRGLYGIDSMPDLRRKKSFPIVRDVAMTLAARKSGISMAMLIRTSINNEEMKIHVFK
KTLQALIYPISSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDL
LNADCLQRAAEKSSKHGAEDKTQNIISAMKERMKIREKNRPEVFEVIQEMFDISKEDFVQ
YTKAAKQSVLDGTSKWSAKITITVLCAQGLQAKDKTGSSDPYVTVQVGKTKRRTKTIFGN
LNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIIEVRTLSGE
MDVWYNLEKRTDKSAVSGALRLKINVEIEGEEKVAPYHVQYTCLHENLFHYLTEVKSNGV
VKIPEVRGDDAWKVYFDDAAQEIVDEFAMRYGIEYIYQAMTHFSCLSSKYMCPGVPAVMS
TLLANINAFYAHTTATTNVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYRDNFPAS
NSERLQDLKSTVDLLTSITFFRMKVLELQSPPRASTVVKDCVRACLDSTYRYIFDNCYDL
YSQLIDQGKKQEVPKEEQGPTTKNLDFWAQLITLMVTIIDEDKTAYTPVLNQFPQELNMG
KISAEIMWTLFAQDMKYALEEHENQRLCKSTDYMNLHFKVKWFYNEYVRELHAFKDAVPE
YSLWFEPFVIQWLDENEDVSMEFLHGALERDKKDGFQQTSDHALFSCSVVDVFTQLNQSF
EIIRKLECPNPEALSHLMRRFAKTINKVLLQYAAIISSYFSSYCDKENVPCILMNNIQQL
RVQLEKMFESMGGKELDQEASTVLKELQAKLSNVLNELSVTYATSFQSIIEDCVRQMSSE
LNQMRGNGTAAANKNSAAIDAEIVLRPLMDFLDKTLSLSAKICEKTVLKRVLKELWKIVL
NRIEKQIVLPPLTDQTGPQMIFSAAKDLGQLSKLKDHVIRDDAKSLTLRQCAIMEVALAT
IKQYFHAGGSGLKKNFLEKSPDLHSLKYALSLYTQTTDALIKKFIDTQKSQSQTTNNSVG
EISVQVDVSTHPGTGEHKVTVKVVAINNLNWQTTAMFRPFVEVCVLGPNLSDKKRKHGTK
TKSNTWSPKYNETFQFILSNEDKPGAYELHLSVKDYCFAREDRVIGMTVIQLQNIAEKGS
CASWYPLLRNIFVDETGLTILRILSQRTNDEVAKEFVRLKSETRSAEETA
NT seq 6633 nt NT seq  +upstreamnt  +downstreamnt
atggtttcctcctgcttaaagagcctgatctcatcttacatatataagatttgcaaagga
atgtttacaaagaaattgggaaatagtacgaaaaggaaagagagttgtcagagcaaaaag
gaacaagatttaactccaactggacaaataaagaatccaaaattttcaaatactttaaaa
agcactgttaaaaagattgctaagtgtccatctgctcgcaacttatcaactgaagaagag
gaaggtaatagagaattttctctttctccaacattcagttacagagttgctattgccaat
ggactgcaaaagcatgtttttgtaacaaacaataataatgaagatttaacacaagatctg
tcttcaaatgatagctcatattctgattcattaagtgaggtaaaaagtaatatcaagaaa
aacgagtacttttcatacacaatgcctgtgagacgcaacagaaagagtttaagcagcctg
gcagcatctgatggaagttctgatggagaacgtactttacacacactaaagcttggagct
ctacgcaaactgaggaaatggaagaagagtcaagaatgtgtctcatcagactctgaacta
agtacatggaagaaancatggggcttgagaagtaaatctctagacagaactggccgtcac
cagaaatcaaatactcttgaacctggcttcagctcaacaggttgcattagtcaaactcat
gatgtcatggaaatgatctttaaagagcttcagggaataagtcaaatagaaacagaactt
tctgaattaagagggcatgtaaatgctctgaaacaatccattgatgaaatttccagtagc
gtagaagtggtacaaaatgaaatcgaacaattgcgaactggatttgtgcagtccagaaga
gaaacccgagacatacatgattacattaagcagataggccatccaggaaacaaagcaagt
cttaggtttctaaatgtgcctgaagagagacttgaaaaaactgaaaacatagtttacaaa
atactaatagaaaaaatggggttctcagaggcacaaagcactattaaaattgagtttgcc
caaagactgggacaacaaagagactgtccaaacgcaaagccaagacccattcttgtttac
tttgagtcatcacagcagagggatttgcttttaaaaaagtcttataaacttaagggaact
ggcattggaatttctacagatgtttttgcccatgacataaaagagaaaaaagaaagagga
ctgccttcttctcaaacttatgagagtatggatatgaagattgtaactgtggagacaaaa
actaaaatgcatgactgggagtcacctgacagtgataaagacgtggaatcagatataaat
aagaacagttatgcaaaggtatctaaatcagcacttcaaataaaaacaagcactacaaag
gggaatgctgagtcctcagatcctaaagaccttaatagaactgctgataataacaccttt
tcaaacagaagaaattatgacagccaatcaccagaatttgacaacgtggaaaagcaacca
aagatgtattattcagacatgactcctctatggcacttgcagaatgactttgctgcacca
aaacttagccgttcagagtccgatttctcaaaattgtgtcagtcctactctgaggatttt
tcagaaaatcagtattttagcaaaacaaatggtagttcattattgtcttcctcagatcgg
gaactttggcagcgaaggcaagatgattctgtcaactggtatggcagttctcaggaacag
actttcgcacaagatgcacaacagtatccagagcaaaatgaagtagagaatacagaaact
gttgacagtggattaagcaatggaataatgtgtgtatctagagacagaagccactatagc
gattctcagctttctttacatgatgacttttcaccatggaaagactggaatcagttggaa
cgaggagcagatttgggtctagactcatctacacaagaagtttttgtgtatgatatgagc
agtccttcagatcaacagacagattttggaaagtgccaaagttctgacctccagtatgac
actgaaagctatgattttacccttgacggaacttccccatcatgtgcaggccttgatagt
gaatcacaaagtcagtggactagtcaatatgatgattatcaggaaacaaattctaaatca
ccttatcagaatcaaaaccgattgcctatgatgtaccgaagtcagagtgaactaccaagt
gatgactcagaagaagcagcccctaagtcatggcacagtcgattaagcatagacctttct
gataagactttcagctttcctaaattcggatctacacttcaacgtgctaagtcagcatta
gaagttgtctggaataaaagtacacaaagtttaagtggatatgaagacagtggatcatct
ttcataggaagatttagaactttgtctcagtctactgcaaatgaatctagcacaacacta
gattctgatgtttatgctgagccttactgctacaaagcagagtatgaagaagatttaatt
gaaccacctggtgagaatgagacagactatgttgaagtaatggaacaagtccttgcaaaa
ctagaaaatagaacaaatagtagtgaaacaagtgagcaggtccaagaatatgaactggga
caacccccatgtggaagtccttatgcaatacttccagaggagcaatatgatgggcagttt
aatggtttggtcagcgaagagatactggaagttgaaagtgacatggatgctcacatggat
gctcacgtggaaataagggaagatgaaaatcagaatgtccaagagatgcttactgaaatt
ccaaagaaaaaaagaatacggccatcattcaaagaagctgctttaaaagcatacaagaaa
caaatgaatgacttggaagacaagatcctttctggagacagcggttctgtggatgaaaag
gctcggatagtaagtggaagctccttggatacttctaagctatatgcaatccaggcattt
agtggatctggccgtggactatatggaattgatagcatgccagaccttcgcagaaagaaa
tctttccccattgttcgagatgtggctatgacacttgcagctcgaaaatctggtatttct
atggccatgctcatccggacatccataaacaatgaggaaatgaaaatacatgttttcaag
aagacattgcaggctttgatctacccaatatcatcaactacgcctcataactttgaagtt
tggacagcaacaactcctacatattgttatgaatgtgaaggtctactttggggcatagcc
aggcaaggaatgagatgcacagaatgtggtgttaaatgtcacgaaaagtgccaagacctc
ctaaatgctgactgtttgcagagagctgctgagaaaagttccaaacatggtgcagaagat
aagacacagaacattattagtgctatgaaagaaagaatgaagatcagggagaagaataga
ccagaggtgtttgaagtgatccaggagatgtttgatatttccaaagaagattttgtacag
tatacaaaagcagcaaagcaaagtgttttggatgggacatccaaatggtcagcaaaaata
actatcacagtgctttgtgctcagggcttacaagctaaggacaaaactggctcaagtgac
ccatatgttactgtgcaagttggcaaaaccaaacggagaacgaagactatttttggaaac
ttgaatccagtatgggatgaaaaattctattttgaatgccataattctacagatagaata
aaggtgagagtatgggatgaagatgatgacatcaaatctagagtaaaacagcatttcaaa
aaggagtccgatgacttccttgggcaaacaatcattgaagtaagaacattgagtggagaa
atggatgtgtggtataatttagaaaagcggacggacaaatcagctgtctctggtgctctt
agattgaaaatcaatgttgaaatagaaggagaggagaaagttgctccctaccatgtgcag
tacacctgtttacatgagaatctattccactacttgacagaagttaaatctaacggtgtg
gtaaaaatccctgaagttagaggtgatgatgcctggaaggtgtactttgatgatgctgca
caagaaattgtagatgaatttgcaatgcgttatggaattgaatatatttatcaagctatg
acgcacttctcctgcctgtcttctaaatatatgtgccctggtgttccagcagttatgagt
acattgttggccaatataaacgctttctatgcacatactacagcaacaacaaatgtgtct
gcctcagacaggtttgctgctactaattttgggagggaaaagttcattaaacttctggat
caattgcataattctctgaggattgatttatctaaatatagggataactttcctgccagc
aattctgaaagacttcaggatctgaaatcaactgtggaccttcttaccagcattactttt
tttcgaatgaaggtccttgaattacaaagcccacctcgagccagtactgtggtgaaagac
tgtgtgagagcctgcctagactcaacatacagatacatttttgacaattgctatgatcta
tactcccaattaatagaccagggtaagaaacaagaagttcctaaagaagaacagggacca
acaacaaagaatttggatttctgggcacagcttattactctgatggtcactatcatagac
gaagataaaacagcatatacacctgtcttgaaccagttccctcaggagctgaacatggga
aaaattagtgctgaaatcatgtggactctgtttgcccaggacatgaagtatgctctggaa
gaacatgaaaatcaacggttatgtaagagcacagattatatgaatttgcacttcaaagtg
aaatggttttataatgaatatgtgcgagagctccatgctttcaaggatgcagtgcctgaa
tattctctatggtttgaaccatttgtcattcagtggctggatgaaaatgaggatgtctca
atggagtttcttcacggagcactggaaagagacaaaaaagatggatttcagcaaacatca
gaccatgcccttttttcatgttcagtggttgacgtcttcacacagctcaatcaaagcttt
gagattatcaggaaactggagtgtcctaatccagaagcactgtctcatttaatgagaagg
tttgcaaagactatcaacaaagtgctgcttcagtatgctgcaattatttcaagttacttc
agttcatactgtgacaaagaaaatgtgccctgtatcttgatgaacaacattcaacagtta
cgagtgcagcttgagaaaatgtttgagtccatgggagggaaggagttggatcaagaagct
agtactgttctaaaagaacttcaagcaaaacttagcaacgtattaaatgaactcagtgta
acgtatgccacaagtttccagtctataatagaagattgtgtaagacaaatgagctctgaa
ctcaatcaaatgagaggaaatgggaccgcagcagccaacaagaacagcgcagccattgat
gcagagattgtacttcggcctctcatggatttcctggacaaaactttaagcctctctgca
aaaatctgtgagaagacagttctgaaacgggttttaaaggagttgtggaagatagtcttg
aacagaatagaaaaacaaattgtgcttccaccactgacagaccaaactgggccccagatg
atattcagtgcagccaaagatcttggacaactctcaaaactcaaggaccatgtgattcga
gatgatgccaaaagcctgacgctgaggcagtgtgcaataatggaagtagcactagctact
ataaagcaatacttccacgctggaggaagtgggctgaaaaagaacttcctggaaaagagc
ccagacctacactccctgaaatacgctcttagtctttacacacaaactactgatgccttg
ataaagaaattcatagacacgcagaagtctcaaagccaaaccactaataattcagtgggg
gagatatctgtacaggtggatgtttctacacatcctggaaccggtgagcacaaggttact
gtaaaagttgtagcaattaataatctcaactggcaaacaacagctatgttccggccattt
gtggaagtctgtgtattaggtcctaacctaagtgacaagaaaaggaaacatggaaccaag
acaaagagcaacacctggtcaccaaaatacaatgagactttccaattcattttgagtaac
gaagataaaccgggagcctatgaacttcatctctcagtgaaagattattgctttgctaga
gaagatcgcgttataggaatgacagttattcagctgcaaaacatagcagagaaaggaagc
tgtgcatcctggtatcccttgctgagaaacatctttgtagatgagactgggttgacaatt
cttaggatactttctcagaggaccaatgatgaagttgctaaagaatttgtaagacttaaa
tcagaaacaagatctgctgaagaaacagcctaa

DBGET integrated database retrieval system