KEGG   Gallus gallus (chicken): 415413Help
Entry
415413            CDS       T01006                                 

Gene name
UNC13C
Definition
(RefSeq) unc-13 homolog C (C. elegans)
  KO
K15293  
protein unc-13 A/B/C
Organism
gga  Gallus gallus (chicken)
Brite
Membrane trafficking [BR:gga04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    415413 (UNC13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
10
AA seq 2220 aa AA seqDB search
MVSSCLKSLISSYIYKICKGMFTKKLGNSTKRKESCQSKKEQDLTPTGQIKNPKFSNTLK
STVKKIAKCPSARNLSTEEEEGNREFSLSPTFSYRVAIANGLQKHVFVTNNNNEDLTQDL
SSNDSSYSDSLSEVKSNIKKNEYFSYTMPVRRNRKSLSSLAASDGSSDGERTLHTLKLGA
LRKLRKWKKSQECVSSDSELSTWKKTWGLRSKSLDRTGRHQKSNTLEPGFSSTGCISQTH
DVMEMIFKELQGISQIETELSELRGHVNALKQSIDEISSSVEVVQNEIEQLRTGFVQSRR
ETRDIHDYIKQIGHPGNKASLRFLNVPEERLEKTENIVYKILIEKMGFSEAQSTIKIEFA
QRLGQQRDCPNAKPRPILVYFESSQQRDLLLKKSYKLKGTGIGISTDVFAHDIKEKKERG
LPSSQTYESMDMKIVTMETKTKMHDWESPDSDKDVESDINKNSYTKVSKSALQIKTSTTK
GNAESPDPKDLNRTADNNTFSNRRNYDSQSPEFDNVEKQPKMYYSDMTPLWHLQNDFAAP
KLSRSESDFSKLCQSYSEDFSENQYFSKTNGSSLLSSSDRELWQRRQDDSVNWYGSSQEQ
TFAQDAQQYPEQNEVENTETVDSGLSNGIMCVSRDRSHYSDSQLSLHDDFSPWKDWNQLE
RGADLGLDSSTQEVFVYDMSSPSDQQTDFGKCQSSDLQYDTESYDFTLDGTSPSCAGLDS
ESQSQWTSQYDDYQETNSKSPYQNQNRLPMMYRSQSELPSDDSEEAAPKSWHSRLSIDLS
DKTFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSFIGRFRTLSQSTANESSTTL
DSDVYAEPYCYKAEYEEDLIEPPGENETDYVEVMEQVLAKLENRTNSSETSEQVQEYELG
QPPCGSPYAILPEEQYDGQFNGLVSEEILEVESDMDAHMDAHVEIREDENQNVQEMLTEI
PKKKRIRPSFKEAALKAYKKQMNDLEDKILSGDSGSVDEKARIVSGSSLDTSKLYAIQAF
SGSGRGLYGIDSMPDLRRKKSFPIVRDVAMTLAARKSGISMAMLIRTSINNEEMKIHVFK
KTLQALIYPISSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDL
LNADCLQRAAEKSSKHGAEDKTQNIISAMKERMKIREKNRPEVFEVIQEMFDISKEDFVQ
YTKAAKQSVLDGTSKWSAKITITVLCAQGLQAKDKTGSSDPYVTVQVGKTKRRTKTIFGN
LNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIIEVRTLSGE
MDVWYNLEKRTDKSAVSGALRLKINVEIEGEEKVAPYHVQYTCLHENLFHYLTEVKSNGV
VKIPEVRGDDAWKVYFDDAAQEIVDEFAMRYGIEYIYQAMTHFSCLSSKYMCPGVPAVMS
TLLANINAFYAHTTATTNVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYRDNFPAS
NSERLQDLKSTVDLLTSITFFRMKVLELQSPPRASTVVKDCVRACLDSTYRYIFDNCYDL
YSQLIDQGKKQEVPKEEQGPTTKNLDFWAQLITLMVTIIDEDKTAYTPVLNQFPQELNMG
KISAEIMWTLFAQDMKYALEEHENQRLCKSTDYMNLHFKVKWFYNEYVRELHAFKDAVPE
YSLWFEPFVIQWLDENEDVSMEFLHGALERDKKDGFQQTSDHALFSCSVVDVFTQLNQSF
EIIRKLECPNPEALSHLMRRFAKTINKVLLQYAAIISSYFSSYCDKENVPCILMNNIQQL
RVQLEKMFESMGGKEKKEGERFSYELDQEASTVLKELQAKLSNVLNELSVTYATSFQSII
EDCVRQMSSELNQMRGNGTAAANKNSAAIDAEIVLRPLMDFLDKTLSLSAKICEKTVLKR
VLKELWKIVLNRIEKQIVLPPLTDQTGPQMIFSAAKDLGQLSKLKDHVIRDDAKSLTLRQ
CAIMEVALATIKQYFHAGGSGLKKNFLEKSPDLHSLKYALSLYTQTTDALIKKFIDTQKS
QSQTTNNSVGEISVQVDVSTHPGTGEHKVTVKVVAINNLNWQTTAMFRPFVEVCVLGPNL
SDKKRKHGTKTKSNTWSPKYNETFQFILSNEDKPGAYELHLSVKDYCFAREDRVIGMTVI
QLQNIAEKGSCASWYPLLRNIFVDETGLTILRILSQRTNDEVAKEFVRLKSETRSAEETA
NT seq 6663 nt NT seq  +upstreamnt  +downstreamnt
atggtttcctcctgcttaaagagcctgatctcatcttacatatataagatttgcaaagga
atgtttacaaagaaattgggaaatagtacgaaaaggaaagagagttgtcagagcaaaaag
gaacaagatttaactccaactggacaaataaagaatccaaaattttcaaatactttaaaa
agcactgttaaaaagattgctaagtgtccatctgctcgcaacttatcaactgaagaagag
gaaggtaatagagaattttctctttctccaacattcagttacagagttgctattgccaat
ggactgcaaaagcatgtttttgtaacaaacaataataatgaagatttaacacaagatctg
tcttcaaatgatagctcatattctgattcattaagtgaggtaaaaagtaatatcaagaaa
aacgagtacttttcatacacaatgcctgtgagacgcaacagaaagagtttaagcagcctg
gcagcatctgatggaagttctgatggagaacgtactttacacacactaaagcttggagct
ctacgcaaactgaggaaatggaagaagagtcaagaatgtgtctcatcagactctgaacta
agtacatggaagaaaacatggggcttgagaagtaaatctctagacagaactggccgtcac
cagaaatcaaatactcttgaacctggcttcagctcaacaggttgcattagtcaaactcat
gatgtcatggaaatgatctttaaagagcttcagggaataagtcaaatagaaacagaactt
tctgaattaagagggcatgtaaatgctctgaaacaatccattgatgaaatttccagtagc
gtagaagtggtacaaaatgaaatcgaacaattgcgaactggatttgtgcagtccagaaga
gaaacccgagacatacatgattacattaagcagataggccatccaggaaacaaagcaagt
cttaggtttctaaatgtgcctgaagagagacttgaaaaaactgaaaacatagtttacaaa
atactaatagaaaaaatggggttctcagaggcacaaagcactattaaaattgagtttgcc
caaagactggggcaacaaagagactgtccaaatgcaaagccaagacccattcttgtttac
tttgagtcatcacaacagagggatttgcttttaaaaaagtcttataaacttaagggaact
ggcattggaatttctacagatgtttttgcccatgacataaaagagaaaaaagaaagagga
ctgccttcttctcaaacttatgagagtatggatatgaagattgtaactatggagacaaaa
actaaaatgcatgactgggagtcacctgacagcgataaagacgtggaatcagatataaat
aagaacagttatacaaaggtatctaaatcagcacttcaaataaaaacaagcactacaaag
gggaatgctgagtccccagatcctaaagaccttaatagaactgctgataataacaccttt
tcaaacagaagaaattatgacagccaatcaccagaatttgacaatgtggaaaagcaacca
aagatgtattattcagacatgactcctctatggcacttgcagaatgactttgctgcacca
aaacttagccgttcagagtccgatttctcaaaattgtgtcagtcctactctgaggatttt
tcagaaaatcagtattttagcaaaacaaatggtagttcattattgtcttcctcagatcgg
gaactttggcagcgaaggcaagatgattctgtcaactggtatggcagttctcaggaacag
actttcgcacaagatgcacaacagtatccagagcaaaatgaagtagagaatacagaaact
gttgacagtggattaagcaatggaataatgtgtgtatctagagacagaagccactatagt
gattctcagctttctttacatgatgacttttcaccatggaaagactggaatcagttggaa
cgaggagcagatttgggtctagactcatctacacaagaagtttttgtgtatgatatgagc
agtccttcagatcaacagacagattttggaaagtgccaaagttctgacctccagtatgac
actgaaagctatgattttacccttgacggaacttccccatcatgtgcaggccttgatagt
gaatcacaaagtcagtggactagtcaatatgatgattatcaggaaacaaattctaaatca
ccttatcagaatcaaaaccgattgcctatgatgtaccgaagtcagagtgaactaccaagt
gatgactcagaagaagcagcccctaagtcatggcacagtcgattaagcatagacctttcc
gataagactttcagctttcctaaattcggatctacacttcaacgtgctaagtcagcatta
gaagtagtctggaataaaagtacacaaagcttaagtggatatgaagacagtggatcatct
ttcataggaagatttagaactttgtctcagtctactgcaaatgaatctagtacaacacta
gattctgatgtttatgctgagccttactgctacaaagcagagtatgaagaagatttaatt
gaaccacctggtgagaatgagacagactatgttgaagtaatggaacaagtccttgcgaaa
ctagaaaatagaacaaatagtagtgaaacaagtgagcaggtccaagaatatgaactggga
caacccccatgtggaagtccttatgcaatacttccagaggagcaatatgatgggcagttt
aatggtttggtcagcgaagagatactggaagttgaaagtgacatggatgctcacatggat
gctcacgtggaaataagggaagatgaaaatcagaatgtccaagagatgcttactgaaatt
ccaaagaaaaaaagaatacggccatcattcaaagaagctgctttaaaagcatacaagaaa
caaatgaatgacttggaagacaagatcctttctggagacagcggttctgtggatgaaaag
gctcggatagtaagtggaagctccttggatacttctaagctatatgcaatccaggcattt
agtggatctggccgtggactatatggaattgatagcatgccagaccttcgcagaaagaaa
tctttccccattgttcgagatgtggctatgacacttgcagctcgaaaatctggtatttct
atggccatgctcatccggacatccataaacaatgaggaaatgaaaatacatgttttcaag
aagacattgcaggctttgatctacccaatatcatcaactacgcctcataactttgaagtt
tggacagcaacaactcctacatattgttatgaatgtgaaggtctactttggggcatagcc
aggcaaggaatgagatgcacagaatgtggtgttaaatgtcacgaaaagtgccaagacctc
ctaaatgctgactgtttgcagagagctgctgagaaaagttccaaacatggtgcagaagat
aagacacagaacattattagtgctatgaaagaaagaatgaagatcagggagaagaataga
ccagaggtgtttgaagtgatccaggagatgtttgatatttccaaagaagattttgtacag
tatacaaaagcagcaaagcaaagtgttttggatgggacatccaaatggtcagcaaaaata
actatcacagtgctttgtgctcagggcttacaagctaaggacaaaactggctcaagtgac
ccatatgttactgtgcaagttggcaaaaccaaacggagaacgaagactatttttggaaac
ttgaatccagtatgggatgaaaaattctattttgaatgccataattctacagatagaata
aaagtgagagtatgggatgaagatgatgacatcaaatctagagtaaaacagcatttcaaa
aaggagtccgatgacttccttgggcaaacaatcattgaagtaagaacattgagtggagaa
atggatgtgtggtataatttagaaaagcggacggacaaatcagctgtctctggtgctctt
agattgaaaatcaatgttgaaatagaaggagaggagaaagttgctccctaccatgtgcag
tacacctgtttacatgagaatctattccactacttgacagaagttaaatctaacggtgtg
gtaaaaatccctgaagttagaggtgatgatgcctggaaggtgtactttgatgatgctgca
caagaaattgtagatgaatttgcaatgcgttatggaattgaatatatttatcaagctatg
acgcacttctcctgcctgtcttctaaatatatgtgccctggtgttccagcagttatgagt
acattgttggccaatataaacgctttctatgcacatactacagcaacaacaaatgtatct
gcctcagacaggtttgctgctactaattttgggagggaaaagttcattaaacttctggat
caattgcataattctctgaggattgatttatctaaatatagggataactttcctgccagc
aattctgaaagacttcaggatctgaaatcaactgtggaccttcttaccagcattactttt
tttcgaatgaaggtccttgaattacaaagcccacctcgagccagtactgtggtgaaagac
tgtgtgagagcctgcctagactcaacatacagatacatttttgacaattgctatgatcta
tactcccaattaatagaccagggtaagaaacaagaagttcctaaagaagaacagggacca
acaacaaagaatttggatttctgggcacagcttattactctgatggtcactatcatagac
gaagataaaacagcatatacacctgtcttgaaccagttccctcaggagctgaacatggga
aaaattagtgctgaaatcatgtggactctgtttgcccaggacatgaagtatgctctggaa
gaacatgaaaatcaacggttatgtaagagcacagattatatgaatttgcacttcaaagtg
aaatggttttataatgaatatgtgcgagagctccatgctttcaaggatgcagtgcctgaa
tattctctatggtttgaaccatttgtcattcagtggctggatgaaaatgaggatgtctca
atggagtttcttcacggagcactggaaagagacaaaaaagatggatttcagcaaacatca
gaccatgcccttttttcatgttcagtggttgacgtcttcacacagctcaatcaaagcttt
gagattatcaggaaactggagtgtcctaatccagaagcactgtctcatttaatgagaagg
tttgcaaagactatcaacaaagtgctgcttcagtatgctgcaattatttcaagttacttc
agttcatactgtgacaaagaaaatgtgccctgtatcttgatgaacaacattcaacagtta
cgagtgcagcttgagaaaatgtttgagtccatgggagggaaggagaagaaagaaggagag
agattctcttatgagttggatcaagaagctagtactgttctaaaagaacttcaagcaaaa
cttagcaacgtattaaatgaactcagtgtaacgtatgccacaagtttccagtctataata
gaagattgtgtaagacaaatgagctctgaactcaatcaaatgagaggaaatgggaccgca
gcagccaacaagaacagcgcagccattgatgcagagattgtacttcggcctctcatggat
ttcctggacaaaactttaagcctctctgcaaaaatctgtgagaagacagttctgaaacgg
gttttaaaggagttgtggaagatagtcttgaacagaatagaaaaacaaattgtgcttcca
ccactgacagaccaaactgggccccagatgatattcagtgcagccaaagatcttggacaa
ctctcaaaactcaaggaccatgtgattcgagatgatgccaaaagcctgacgctgaggcag
tgtgcaataatggaagtagcactagctactataaagcaatacttccacgctggaggaagt
gggctgaaaaagaacttcctggaaaagagcccagacctacactccctgaaatacgctctt
agtctttacacacaaactactgatgccttgataaagaaattcatagacacgcagaagtct
caaagccaaaccactaataattcagtgggggagatatctgtacaggtggatgtttctaca
catcctggaaccggtgagcacaaggttactgtaaaagttgtagcaattaataatctcaac
tggcaaacaacagctatgttccggccatttgtggaagtctgtgtattaggtcctaaccta
agtgacaagaaaaggaaacatggaaccaagacaaagagcaacacctggtcaccaaaatac
aatgagactttccaattcattttgagtaacgaagataaaccgggagcctatgaacttcat
ctctcagtgaaagattattgctttgctagagaagatcgcgttataggaatgacagttatt
cagctgcaaaacatagcagagaaaggaagctgtgcatcctggtatcccttgctgagaaac
atctttgtagatgagactgggttgacaattcttaggatactttctcagaggaccaatgat
gaagttgctaaagaatttgtaagacttaaatcagaaacaagatctgctgaagaaacagcc
taa

DBGET integrated database retrieval system