KEGG   Gallus gallus (chicken): 415419Help
Entry
415419            CDS       T01006                                 

Gene name
MAPK6
Definition
mitogen-activated protein kinase 6 (EC:2.7.11.24)
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
10
AA seq 721 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNCVYIVQEYMETDLANLLE
QGPLLEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLNVIPVYIRNDMTEPHKPLTQLLPGISPEALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPTDEPISSHPFHIEDEVDDILLMDESHSHIYNWERYHES
QFSDHDWPIHNNYEADEVQRDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTHFS
TEPCWQYSDHHENKYCDLECSHTCNYKMRSSSYLDNLVWRDSEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCEKNGLVKAQIALEEASQQLVEKEREKNQGFDFDSFIAETIQLSLQ
HEPTDVDKLNDLNSSVSQMESKGLISKSVSREKQEKGMANLAQLGALYQTSWESQFVSNG
EECFLIDQFCCEVRKDEQVEKENTYTSYLDKFFSKKEDAEMLEPEPVEEGKLGEKERGES
FLSNSGELFFNKQLEAIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKHL
N
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaatttgaaagtctcatgaacattcatggttttgatctgggctctcggtat
atggacttaaaaccactgggctgtggtggaaatggcttagttttttctgctgtcgacaat
gactgtgacaagagagtggctgtcaagaaaattgtccttacggatccccagagtgttaaa
catgctctacgtgagatcaaaattattagaagacttgaccacgataacattgtcaaagta
tttgaaatccttggtcctagtggaagccagttaacagatgatgtgggctccctgacagag
ctgaactgtgtttacattgtccaggaatacatggagacggatctggctaatctgctagag
caaggccctttactggaagatcatgccagacttttcatgtaccagctgctacgtgggctc
aagtatatccactctgcaaatgttctgcatagagatctcaaaccagctaaccttttcatt
aataccgaagacttggtgctgaagattggggacttcggtcttgcacgaatcatggatcct
cattattcccacaagggccatctttctgaaggattggttactaaatggtacagatcaccc
cggcttttactttctcctaacaactacactaaagccattgacatgtgggctgcaggttgc
atctttgctgaaatgctgactgggaaaaccctctttgcaggtgcgcatgaacttgaacag
atgcagttgattctagaatctattcctgttgtacatgaggaggaccgtcaggagcttctc
aatgtaattccagtttacattagaaatgatatgactgagccacacaaacctttaactcag
ttgcttccaggcatcagtcctgaagcactggactttttggagcaaattttgacatttagt
cccatggatcgattgacagcagaagaagctttgtcccatccttacatgagcatttattcc
tttccaacggatgagcctatttcaagtcatccttttcacattgaagatgaggttgatgat
attctgctgatggatgaaagtcacagccatatttataattgggaaagataccatgaaagt
cagttttcagaccatgactggcctattcataataactatgaagctgatgaagttcagcgt
gatccaagggctctttctgatgttactgatgaggaagaagtgcaagtagatcctcgcaaa
tatttggatggagatcgtgaaaagtatctggaggatcctgcttttgacacccacttctct
actgagccttgctggcagtattcagatcaccatgaaaacaaatactgtgatctggaatgt
agtcacacttgtaattacaaaatgaggtcatcttcatacctagataatttagtttggcga
gacagtgaagttaaccattactatgagcccaagcttattatagatctttcaaactggaag
gaacagagcaaagaaaagtctgataagaaaggcaagtctaaatgtgaaaagaatggattg
gtgaaagcccagatagcgcttgaggaagcatcacagcaacttgttgaaaaagaaagggag
aagaatcaaggatttgactttgattcgtttatagcggaaaccattcagcttagtttacag
cacgagcctactgatgttgataaattaaatgacttgaatagctcggtgtctcagatggag
tcgaaaggattaatatcgaagtcggtaagcagagagaagcaggagaagggaatggccaac
ttggcccagttaggagctctgtaccaaacttcttgggagagtcagtttgtaagtaacggg
gaggagtgcttcctcatagaccagttctgttgtgaggtgaggaaagacgaacaagttgaa
aaagaaaatacttacaccagttatttggacaaattctttagtaagaaagaagatgctgaa
atgctagaacctgagccagtagaagaggggaagcttggggagaaggagagaggagagagc
tttctcagtaacagtggagaactcttcttcaacaagcagcttgaggctataggtattcct
cagtttcatagccccgtcggttcgccactgaaatccatacaggccacgctaacgccctct
gctatgaagtcatctccccagattccccacaaaacgtacagcagcattctgaaacatcta
aattaa

DBGET integrated database retrieval system