KEGG   Gallus gallus (chicken): 415448Help
Entry
415448            CDS       T01006                                 

Gene name
ITGB1BP3
Definition
(RefSeq) integrin beta 1 binding protein 3
  KO
K10524  
nicotinamide/nicotinate riboside kinase [EC:2.7.1.22 2.7.1.173]
Organism
gga  Gallus gallus (chicken)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    415448 (ITGB1BP3)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     415448 (ITGB1BP3)
    2.7.1.173  nicotinate riboside kinase
     415448 (ITGB1BP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
Position
10
AA seq 208 aa AA seqDB search
MKIIIGIGGVTNGGKTTLTRRLMQALPNCSVVHQDDFFKPQDEIEVEDGFKQYDVISALD
MEAMMSTINAWIKNPVKFERSHGINNTLDAQISPDREGRDEAVHILIVEGFLLYTYRPLI
DVFHHRYFLSIPYEECKRRRSSRNYTVPDPPGLFDGHVWPMYVKHRKIMEDLGVDVVHLN
GTKSKEELFNEVYGQIQNKIEELLNMQK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcatcatcggcatcggcggggtcaccaacgggggcaagaccaccctcacccgc
aggctgatgcaggccctgcccaactgcagcgtggtgcaccaggacgacttcttcaagcct
caagatgaaatagaagttgaagatggctttaagcagtatgacgtgatcagtgcgttagat
atggaggcgatgatgagtaccatcaacgcttggataaagaacccggtcaagtttgaacgc
tctcatgggatcaacaacacgctggatgcccagatctcaccagacagggagggaagagat
gaagcagtccacatccttattgttgagggcttcctgctttacacctacaggcccctgatt
gacgtattccaccatcggtacttcctttccattccatatgaagagtgtaaaaggagaaga
agttcaaggaattacactgtacctgatccacctggattgtttgatggccatgtttggcct
atgtatgtcaagcacaggaagataatggaagatcttggtgttgatgtggtgcacttgaat
ggaacaaaatccaaggaggaactgtttaatgaggtatatgggcagatccaaaataagatc
gaagaattacttaacatgcagaaataa

DBGET integrated database retrieval system