KEGG   Gallus gallus (chicken): 415451Help
Entry
415451            CDS       T01006                                 

Gene name
USP8
Definition
ubiquitin specific peptidase 8
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    415451 (USP8)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     415451 (USP8)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   415451 (USP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
10
AA seq 1239 aa AA seqDB search
MTAASVDSASPFPPSPPSRWFHSRLTFLKEMICLLPASFCRGLQHRMEPGPLLLFPSVQA
QTLQHALGPPRSYSTRTPTRAVPQTSAASGRPGPGSAFPPRKLLVEACKKLYHPRREINN
NINMPAVASVPKELYLCTSLKDLNQKTEIKHEKTNSTKSYVQSALKIFKAAEECRLDRDE
EKAYILYMKYVAVYNFIKKRPDFKQQQDYFHSILGPTNLKKAIEEAERLSDSLKLRYEEA
EVRKKLEERDRQELQKKQEPKDDGKSSAKTSSESTVDCKGKSQRINGETKHSLERKDQAE
SFSGAVTAEKLFAMMTDKTIELIIMDTRSLKDYQESCIPRSVSVPEEAISPGVTASWIEA
RLPEDSKDPWKKRGHFDYVVLLDWFSSAEDLNIGTTLRSLKDALFKWESKTILQNEPLVL
EGGYENWLLCFPQYTTNAKVTPPQHGKSEAVTVSLDFTYPSLEEPVPAPPVAPIKPSPTE
VVENEETGANLEERLKSLNRPSVEGAAVPKPDSSFVVNPASITRSIPEVDRSKKPSIKIP
DDNKSKSESTLSDSQPIEKGRVVPDRSTKPLLDAKSVLTEEEKSRVHAETAALMEKNRRE
KELRERQKEEQKERLKREKEEQEQKAKEEQREKEHKEKLQQSKEEREQKERDEQIKREQE
EKEKEKARKEAIEAKKQNKNEPESIDAKKVETDKISIEKREKGTRTPDTQRRVLGDVSPN
KQTEVKGQPDSGAQKPGPLREDSEQDTERLKSQREPLTRARSEEMGRVIPGLPDGWAKFL
DPITGTFRYYHSPTNTVQMYPPEMAPSSTPPATPPTRKPKPQVAVEREREHSKLKRSYSS
PDITQAIQEEEKKRIPVTPAVNRENKPAYYPKTEISRLSASQIRNLNPVFGGSGPALTGL
RNLGNTCYMNSILQCLCNAPHLAEYFNKNLYQDDINRSNFLGHKGEVAEEFGVIMKALWT
GQYKYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENND
HLDDLKAAELAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLAST
SKCTLQECLRLFSKEEKLTDNNRFYCSHCKTRRDSLKKIEIWKLPPVLLVHLKRFSYDGR
WKQKLQTSVDFPLETLDLSQYVIGPKNNLKRYNLFSVSNHYGGLDGGHYTAYCKNASKQR
WFKFDDHEVSEISASSVKSSAAYILFYTSYEQRAVDMAT
NT seq 3720 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagccagtgtggactcagcatcacctttcccaccctctccaccgtcacgatgg
tttcacagccgcctgactttcctaaaggagatgatctgtcttttgccggcttcattttgc
agaggactgcagcacaggatggagccagggccgctgcttcttttcccctccgtacaagca
cagactctccagcacgcgctcggccctccccgctcctattccacccgcacaccgacgcgg
gccgtccctcagacgtcagctgcctctgggcggcccgggcccggcagcgcgttcccccct
agaaaactactggtagaagcttgtaagaagttgtaccatcctagaagggagataaataac
aacattaacatgcctgctgtggcatctgtacctaaggagctgtatctgtgtacttcattg
aaagatctcaaccagaagacagaaataaagcatgaaaagaccaatagtacaaagagttat
gtgcagagcgcccttaagattttcaaagccgcagaagaatgcagattggaccgagatgaa
gagaaagcttatatcctgtacatgaaatatgtggctgtttataattttattaaaaagaga
cctgattttaagcagcaacaggattatttccattccattcttgggcctacaaatttaaaa
aaagctattgaagaagctgaaagactgtcagacagccttaaactcagatatgaggaagct
gaagtacggaaaaaacttgaagagagggacagacaggaactgcagaaaaagcaagaacca
aaagatgatggaaagagttcagccaaaacctcatcagaaagtacagtagattgcaaagga
aaaagccaaaggattaatggcgagacgaagcattcactggaaagaaaggatcaggctgag
agttttagtggagcagtgacagctgagaagttgtttgcaatgatgacagacaaaaccatt
gaattgattataatggatactcgaagcttgaaggactaccaggaatcctgtattccaaga
tctgtcagcgttccagaagaagctatcagtcctggagttactgctagttggattgaagct
agactcccagaggattctaaagatccatggaagaagagaggacactttgattatgttgta
ctgctggactggtttagttctgcagaagacttaaatataggaacaactcttcggagtctg
aaagatgcactttttaagtgggaaagcaaaactatactgcagaatgaacctttggttcta
gaaggaggctatgaaaactggctcctttgctttccccagtacacaacaaatgctaaagta
actccaccccaacatggcaagagtgaagcagtaaccgtgtctttggattttacgtatcca
tctctagaagagccagttcctgctccacctgttgcccctataaagccttctccaacagaa
gtggttgaaaatgaagaaactggagctaatttggaagagaggctaaaatcactgaacaga
ccaagtgtggaaggtgctgctgttccaaaacctgacagctcatttgtagttaatccagca
tcgataacaagaagtatccctgaggttgatcgttctaaaaagccttcaataaagatacct
gatgataataaatcaaaatctgaaagtacgctcagtgacagccaacctattgagaagggc
cgcgtggttccggaccggtccacaaagccattacttgatgctaagagtgttctgacagaa
gaagaaaaaagccgtgtgcatgcagaaactgctgctctgatggagaaaaacagacgagaa
aaagaactgcgggagaggcagaaggaagaacaaaaagagagactcaagcgagaaaaggaa
gaacaggagcaaaaggcaaaggaagaacagagagaaaaggaacacaaagaaaagctacag
caatccaaggaggagagggaacagaaggagagagatgagcagataaaaagagaacaggag
gagaaggaaaaagaaaaagcacgcaaagaagcaatagaagcaaaaaagcaaaataaaaat
gaaccagaaagcattgatgcaaaaaaggttgagactgacaaaatatctatagaaaaaaga
gaaaagggaactcgaacaccggatacgcagagacgtgtactgggtgatgtatctccaaat
aagcaaactgaggttaaaggacaaccagacagtggagctcaaaagccaggaccccttaga
gaggattctgaacaagatactgaaagacttaaatcccagcgggagccattgaccagagca
cgaagtgaagaaatggggagggtaataccaggactgcctgacggttgggcaaagtttctg
gatccaatcactggaacctttcgttactatcactcgccaacgaacactgttcagatgtat
ccaccagaaatggctccctcatccacccctccagccaccccaccaacccgcaaacccaag
ccacaggtggctgttgagcgggaacgagagcactccaaactgaaacgctcctactcatcc
ccagacataacccaagccattcaggaggaagagaagaaaagaattcctgtaactcctgca
gtcaatcgtgaaaataaaccagcctattaccctaaaacagaaatttcaagactctctgcg
tcacagattaggaaccttaatcctgtgtttgggggatcgggaccagctcttacaggactt
cgtaatctagggaacacttgctatatgaactccatattacagtgtctgtgcaacgcacct
cacctagctgagtattttaacaaaaacttgtatcaagatgatattaacaggtccaatttc
ctggggcataaaggtgaagtggctgaagaatttggagtaataatgaaagctttgtggaca
ggacagtataaatatatcagtccaaaagacttcaaaattacaattgggaagattaatgac
cagtttgcaggatacagccagcaagactcccaggagctgcttctctttctcatggacggc
ttgcacgaagacctcaataaagctgacaacaggaaaagatacaaggaagaaaacaatgat
catctcgatgacctcaaagcagcagaactagcctggcagaagcacaaacagctcaacgaa
tccattattgtggcactcttccaaggccagttcaaatcaacagtgcagtgtctcacgtgt
cacaagaagtcccggacctttgaggctttcatgtatttgtccttaccacttgcatccact
agtaaatgcacactgcaggaatgccttagattgttctccaaagaggaaaagctcaccgat
aacaacagattttactgtagccattgcaaaactcgaagggattctttgaaaaaaatagaa
atttggaaattaccacctgtgcttctcgtgcacctgaaacgattttcctatgatggaaga
tggaagcaaaagcttcagacctctgtagatttcccattggaaactcttgacctttcacag
tatgttattggtccaaagaataatttgaagagatacaatctattttcagtatcaaatcat
tatggtgggttggatggagggcactacaccgcctactgcaaaaacgcctcaaaacagcgc
tggtttaagtttgatgaccatgaagtatctgagatctcagcatcatctgtgaaatcctca
gctgcatatattctcttttacacttcttatgaacaaagagcagtggatatggccacataa

DBGET integrated database retrieval system