KEGG   Gallus gallus (chicken): 415451Help
Entry
415451            CDS       T01006                                 

Gene name
USP8
Definition
(RefSeq) ubiquitin specific peptidase 8
  KO
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    415451 (USP8)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     415451 (USP8)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   415451 (USP8)
Ubiquitin system [BR:gga04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    415451 (USP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
10
AA seq 1116 aa AA seqDB search
MPAVASVPKELYLCTSLKDLNQKTEIKHEKTNSTKSYVQSALKIFKAAEECRLDRDEEKA
YILYMKYVAVYNFIKKRPDFKQQQDYFHSILGPTNLKKAIEEAERLSDSLKLRYEEAEVR
KKLEERDRQELQKKQEPKDDGKSSAKTSSESTVDCKGKSQRINGETKHSLERKDQAESFS
GAVTAEKLFAMMTDKTIELIIMDTRSLKDYQESCIPRSVSVPEEAISPGVTASWIEARLP
EDSKDPWKKRGHFDYVVLLDWFSSAEDLNIGTTLRSLKDALFKWESKTILQNEPLVLEGG
YENWLLCFPQYTTNAKVTPPQHGKSEAVTVSLDFTYPSLEEPVPAPPVAPIKPSPTEVVE
NEETGANLEERLKSLNRPSVEGAAVPKPDSSFVVNPASITRSIPEVDRSKKPSIKIPDDN
KSKSESTLSDSQPIEKGRVVPDRSTKPLLDAKSVLTEEEKSRVHAETAALMEKNRREKEL
RERQKEEQKERLKREKEEQEQKAKEEQREKEHKEKLQQSKEEREQKERDEQIKREQEEKE
KEKARKEAIEAKKQNKNEPESIDAKKVETDKISIEKREKGTRTPDTQRRVLGDVSPNKQT
EVKGQPDSGAQKPGPLREDSEQDTERLKSQREPLTRARSEEMGRVIPGLPDGWAKFLDPI
TGTFRYYHSPTNTVQMYPPEMAPSSTPPATPPTRKPKPQVAVEREREHSKLKRSYSSPDI
TQAIQEEEKKRIPVTPAVNRENKPAYYPKTEISRLSASQIRNLNPVFGGSGPALTGLRNL
GNTCYMNSILQCLCNAPHLAEYFNKNLYQDDINRSNFLGHKGEVAEEFGVIMKALWTGQY
KYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLD
DLKAAELAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKC
TLQECLRLFSKEEKLTDNNRFYCSHCKTRRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQ
KLQTSVDFPLETLDLSQYVIGPKNNLKRYNLFSVSNHYGGLDGGHYTAYCKNASKQRWFK
FDDHEVSEISASSVKSSAAYILFYTSYEQRAVDMAT
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtggcatctgtacctaaggagctgtatctgtgtacttcattgaaagatctc
aaccagaagacagaaataaagcatgaaaagaccaatagtacaaagagttatgtgcagagc
gcccttaagattttcaaagccgcagaagaatgcagattggaccgagatgaagagaaagct
tatatcctgtacatgaaatatgtggctgtttataattttattaaaaagagacctgatttt
aagcagcaacaggattatttccattccattcttgggcctacaaatttaaaaaaagctatt
gaagaagctgaaagactgtcagacagccttaaactcagatatgaggaagctgaagtacgg
aaaaaacttgaagagagggacagacaggaactgcagaaaaagcaagaaccaaaagatgat
ggaaagagttcagccaaaacctcatcagaaagtacagtagattgcaaaggaaaaagccaa
aggattaatggcgagacgaagcattcactggaaagaaaggatcaggctgagagttttagt
ggagcagtgacagctgagaagttgtttgcaatgatgacagacaaaaccattgaattgatt
ataatggatactcgaagcttgaaggactaccaggaatcctgtattccaagatctgtcagc
gttccagaagaagctatcagtcctggagttactgctagttggattgaagctagactccca
gaggattctaaagatccatggaagaagagaggacactttgattatgttgtactgctggac
tggtttagttctgcagaagacttaaatataggaacaactcttcggagtctgaaagatgca
ctttttaagtgggaaagcaaaactatactgcagaatgaacctttggttctagaaggaggc
tatgaaaactggctcctttgctttccccagtacacaacaaatgctaaagtaactccaccc
caacatggcaagagtgaagcagtaaccgtgtctttggattttacgtatccatctctagaa
gagccagttcctgctccacctgttgcccctataaagccttctccaacagaagtggttgaa
aatgaagaaactggagctaatttggaagagaggctaaaatcactgaacagaccaagtgtg
gaaggtgctgctgttccaaaacctgacagctcatttgtagttaatccagcatcgataaca
agaagtatccctgaggttgatcgttctaaaaagccttcaataaagatacctgatgataat
aaatcaaaatctgaaagtacgctcagtgacagccaacctattgagaagggccgcgtggtt
ccggaccggtccacaaagccattacttgatgctaagagtgttctgacagaagaagaaaaa
agccgtgtgcatgcagaaactgctgctctgatggagaaaaacagacgagaaaaagaactg
cgggagaggcagaaggaagaacaaaaagagagactcaagcgagaaaaggaagaacaggag
caaaaggcaaaggaagaacagagagaaaaggaacacaaagaaaagctacagcaatccaag
gaggagagggaacagaaggagagagatgagcagataaaaagagaacaggaggagaaggaa
aaagaaaaagcacgcaaagaagcaatagaagcaaaaaagcaaaataaaaatgaaccagaa
agcattgatgcaaaaaaggttgagactgacaaaatatctatagaaaaaagagaaaaggga
actcgaacaccggatacgcagagacgtgtactgggtgatgtatctccaaataagcaaact
gaggttaaaggacaaccagacagtggagctcaaaagccaggaccccttagagaggattct
gaacaagatactgaaagacttaaatcccagcgggagccattgaccagagcacgaagtgaa
gaaatggggagggtaataccaggactgcctgacggttgggcaaagtttctggatccaatc
actggaacctttcgttactatcactcgccaacgaacactgttcagatgtatccaccagaa
atggctccctcatccacccctccagccaccccaccaacccgcaaacccaagccacaggtg
gctgttgagcgggaacgagagcactccaaactgaaacgctcctactcatccccagacata
acccaagccattcaggaggaagagaagaaaagaattcctgtaactcctgcagtcaatcgt
gaaaataaaccagcctattaccctaaaacagaaatttcaagactctctgcgtcacagatt
aggaaccttaatcctgtgtttgggggatcgggaccagctcttacaggacttcgtaatcta
gggaacacttgctatatgaactccatattacagtgtctgtgcaacgcacctcacctagct
gagtattttaacaaaaacttgtatcaagatgatattaacaggtccaatttcctggggcat
aaaggtgaagtggctgaagaatttggagtaataatgaaagctttgtggacaggacagtat
aaatatatcagtccaaaagacttcaaaattacaattgggaagattaatgaccagtttgca
ggatacagccagcaagactcccaggagctgcttctctttctcatggacggcttgcacgaa
gacctcaataaagctgacaacaggaaaagatacaaggaagaaaacaatgatcatctcgat
gacctcaaagcagcagaactagcctggcagaagcacaaacagctcaacgaatccattatt
gtggcactcttccaaggccagttcaaatcaacagtgcagtgtctcacgtgtcacaagaag
tcccggacctttgaggctttcatgtatttgtccttaccacttgcatccactagtaaatgc
acactgcaggaatgccttagattgttctccaaagaggaaaagctcaccgataacaacaga
ttttactgtagccattgcaaaactcgaagggattctttgaaaaaaatagaaatttggaaa
ttaccacctgtgcttctcgtgcacctgaaacgattttcctatgatggaagatggaagcaa
aagcttcagacctctgtagatttcccattggaaactcttgacctttcacagtatgttatt
ggtccaaagaataatttgaagagatacaatctattttcagtatcaaatcattatggtggg
ttggatggagggcactacaccgcctactgcaaaaacgcctcaaaacagcgctggtttaag
tttgatgaccatgaagtatctgagatctcagcatcatctgtgaaatcctcagctgcatat
attctcttttacacttcttatgaacaaagagcagtggatatggccacataa

DBGET integrated database retrieval system