KEGG   Gallus gallus (chicken): 415549Help
Entry
415549            CDS       T01006                                 

Gene name
MAP2K1
Definition
mitogen-activated protein kinase kinase 1 (EC:2.7.12.2)
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Oocyte meiosis
Vascular smooth muscle contraction
Dorso-ventral axis formation
VEGF signaling pathway
Focal adhesion
Gap junction
Toll-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Influenza A
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:gga04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:gga04012]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:gga04370]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:gga04068]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:gga04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:gga04114]
Cellular Processes; Cell communication; Focal adhesion [PATH:gga04510]
Cellular Processes; Cell communication; Gap junction [PATH:gga04540]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:gga04620]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:gga04910]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:gga04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:gga04914]
Organismal Systems; Endocrine system; Melanogenesis [PATH:gga04916]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:gga04270]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:gga04320]
Human Diseases; Infectious diseases; Influenza A [PATH:gga05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
10
AA seq 395 aa AA seqDB search
MPKKKPGPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLIMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAIGRYPIPPPDSKELELMFGCPVEGDSPVTETSPRQRTPGRPMS
SYGPDSRPPMAIFELLDYIVNEPPPKLPNGVFGSEFQDFVNKCLIKNPAERADLKQLMIH
AFIKRSEAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagaagaagccagggccgatccagctcaaccccgctccggatggctccgccgtc
aacgggaccagctctgccgagacaaacttggaagctcttcagaagaagctggaagagcta
gagctggatgaacagcaaaggaagcgccttgaagctttccttacccagaaacaaaaagtt
ggggagctgaaggatgatgacttcgagaagatcagtgagctgggagcagggaatggcggg
gtggtgttcaaagtatctcacaagccttctggcctcatcatggcaagaaaattgattcat
ctagaaatcaagccagctattcgaaaccagatcatccgtgagctgcaggttctacatgag
tgcaattcaccatacatagtgggcttttatggagctttttacagtgatggggaaatcagc
atttgcatggaacacatggatggtggctcattggatcaagtgctgaaaaaggctggaaga
attccagagcagatactgggcaaagtcagcattgcagtaataaaaggactcacatatctg
agagaaaagcataaaataatgcacagagatgttaaaccatctaacatcttggtaaactct
agaggtgagatcaagctttgtgattttggtgtcagtggacaactgatagattctatggca
aactcatttgttggcacgcgctcctacatgtctccggaaagactgcagggaactcattat
tcagtgcagtcagatatatggagtatggggctgtctctggtagaaatggccattggcaga
tacccgattcctcctcctgactctaaggagctcgagttgatgtttggctgcccggtagag
ggagattctccagtcacagagacctcacccaggcaaagaacacctggtcgaccaatgagc
tcctatggaccagacagcagacccccgatggcaatctttgaacttctggattacatcgtc
aatgagccacctccaaaactgcccaatggtgtctttggttctgaatttcaagattttgtt
aacaaatgtttaattaaaaatcctgctgagagagctgatttgaagcagctgatgattcac
gctttcattaagagatctgaagcagaggaggtggattttgcaggatggctttgctcaacc
ataggccttaaccaaccgagtacacccacgcatgctgctggagtctga

DBGET integrated database retrieval system