KEGG   Gallus gallus (chicken): 415549Help
Entry
415549            CDS       T01006                                 

Gene name
MAP2K1
Definition
(RefSeq) mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04012  ErbB signaling pathway
gga04068  FoxO signaling pathway
gga04114  Oocyte meiosis
gga04140  Autophagy - animal
gga04150  mTOR signaling pathway
gga04210  Apoptosis
gga04218  Cellular senescence
gga04270  Vascular smooth muscle contraction
gga04370  VEGF signaling pathway
gga04371  Apelin signaling pathway
gga04510  Focal adhesion
gga04540  Gap junction
gga04620  Toll-like receptor signaling pathway
gga04810  Regulation of actin cytoskeleton
gga04910  Insulin signaling pathway
gga04912  GnRH signaling pathway
gga04914  Progesterone-mediated oocyte maturation
gga04916  Melanogenesis
gga05164  Influenza A
Module
gga_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    415549 (MAP2K1)
   04012 ErbB signaling pathway
    415549 (MAP2K1)
   04370 VEGF signaling pathway
    415549 (MAP2K1)
   04371 Apelin signaling pathway
    415549 (MAP2K1)
   04068 FoxO signaling pathway
    415549 (MAP2K1)
   04150 mTOR signaling pathway
    415549 (MAP2K1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    415549 (MAP2K1)
  Cell growth and death
   04114 Oocyte meiosis
    415549 (MAP2K1)
   04210 Apoptosis
    415549 (MAP2K1)
   04218 Cellular senescence
    415549 (MAP2K1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    415549 (MAP2K1)
   04540 Gap junction
    415549 (MAP2K1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    415549 (MAP2K1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    415549 (MAP2K1)
  Endocrine system
   04910 Insulin signaling pathway
    415549 (MAP2K1)
   04912 GnRH signaling pathway
    415549 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    415549 (MAP2K1)
   04916 Melanogenesis
    415549 (MAP2K1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    415549 (MAP2K1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    415549 (MAP2K1)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     415549 (MAP2K1)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: STE group
  STE7 family
   415549 (MAP2K1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Seadorna_VP7 Kinase-like DUF3216
Motif
Other DBs
NCBI-GeneID: 415549
NCBI-ProteinID: NP_001005830
CGNC: 50013
Ensembl: ENSGALG00000007687
UniProt: Q5ZIF0
Position
10
AA seq 395 aa AA seqDB search
MPKKKPGPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLIMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAIGRYPIPPPDSKELELMFGCPVEGDSPVTETSPRQRTPGRPMS
SYGPDSRPPMAIFELLDYIVNEPPPKLPNGVFGSEFQDFVNKCLIKNPAERADLKQLMIH
AFIKRSEAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagaagaagccagggccgatccagctcaaccccgctccggatggctccgccgtc
aacgggaccagctctgccgagacaaacttggaagctcttcagaagaagctggaagagcta
gagctggatgaacagcaaaggaagcgccttgaagctttccttacccagaaacaaaaagtt
ggggagctgaaggatgatgacttcgagaagatcagtgagctgggagcagggaatggcggg
gtggtgttcaaagtatctcacaagccttctggcctcatcatggcaagaaaattgattcat
ctagaaatcaagccagctattcgaaaccagatcatccgtgagctgcaggttctacatgag
tgcaattcaccatacatagtgggcttttatggagctttttacagtgatggggaaatcagc
atttgcatggaacacatggatggtggctcattggatcaagtgctgaaaaaggctggaaga
attccagagcagatactgggcaaagtcagcattgcagtaataaaaggactcacatatctg
agagaaaagcataaaataatgcacagagatgttaaaccatctaacatcttggtaaactct
agaggtgagatcaagctttgtgattttggtgtcagtggacaactgatagattctatggca
aactcatttgttggcacgcgctcctacatgtctccggaaagactgcagggaactcattat
tcagtgcagtcagatatatggagtatggggctgtctctggtagaaatggccattggcaga
tacccgattcctcctcctgactctaaggagctcgagttgatgtttggctgcccggtagag
ggagattctccagtcacagagacctcacccaggcaaagaacacctggtcgaccaatgagc
tcctatggaccagacagcagacccccgatggcaatctttgaacttctggattacatcgtc
aatgagccacctccaaaactgcccaatggtgtctttggttctgaatttcaagattttgtt
aacaaatgtttaattaaaaatcctgctgagagagctgatttgaagcagctgatgattcac
gctttcattaagagatctgaagcagaggaggtggattttgcaggatggctttgctcaacc
ataggccttaaccaaccgagtacacccacgcatgctgctggagtctga

DBGET integrated database retrieval system