KEGG   Gallus gallus (chicken): 415557Help
Entry
415557            CDS       T01006                                 

Gene name
MAP2K5
Definition
mitogen-activated protein kinase kinase 5 (EC:2.7.12.2)
Orthology
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Gap junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    415557 (MAP2K5)
 Cellular Processes
  Cell communication
   04540 Gap junction
    415557 (MAP2K5)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     415557 (MAP2K5)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   415557 (MAP2K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
10
AA seq 449 aa AA seqDB search
MLWLLCGPSRAMESHQVLVIRIKIPDGGAVDWTVHSAPQLLFRDVLDVIGQVLPDATTTA
FEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIYPRACKPPGKRNIHG
LKVNTRAGSANNSSSAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDILGHGNGGT
VYKAYHVPSGKILAVKVIPLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISL
CTEFMDGGSLDVYRKIPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKL
CDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQI
QKNQGSLMPLQLLQCIVDEESPVLPAGEFSEPFVHFITQCMRKQPKERPAPEDLMGHPFI
VQYNDGHAEVVSMWVCRTLEERRSAQGAP
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgctctggctgctctgcggcccctcccgcgccatggagagccaccaggtgctggtgatc
cgcatcaagatccccgacggcggggccgtggactggaccgtgcactcggcgccccagctg
ctcttcagggacgtgctggatgtcatcggtcaagttctgccagatgcaacgacaacagcg
tttgagtatgaagatgaggacggtgatcggattactgtcagaagtgatgaagaaatgaag
gccatgctgtcctattattactccactgtaatggaacagcaagtaaatggacagttaata
gagcctctccagatatatccaagagcctgcaagcctcctgggaaacggaacatacatggc
ctgaaggtaaatacgcgagcagggtctgctaataatagcagttccgcagtctcggattcc
cttccaagcaatagcttaaagaagtcttctgcagagctgaagaagatacttgctaatggc
cagatgaatgaacaagacatacggtatcgagacatcctcggtcatggcaatggaggcacg
gtctacaaggcgtaccacgtccctagtgggaaaatcctggcagtaaaggtcatacccttg
gatataacgctggagctccagaaacagatcatgtcagagttggagattctctataagtgc
gactcgtcatatatcataggattttatggtgctttttttgtagaaaacagaatttctttg
tgtacagagttcatggatgggggttctttggatgtttatagaaaaattccagagcacgta
ctgggaagaatagcagtagctgtcgtgaaaggccttacgtatttatggagtctgaagatt
ttgcacagagacgtgaagccgtccaacatgctggtgaacacgcgagggcaggtgaagctg
tgtgacttcggggtgagcacccagctggtgaattctatagccaagacgtatgtcggaaca
aatgcttacatggcgccggaacggatttcgggagagcaatacgggattcattcggacgtt
tggagtttagggatttccttcatggagcttgctcttgggaggtttccatatcctcagatt
cagaaaaaccagggatctttaatgcctctccagttattgcagtgcattgttgatgaggag
tcgcccgtccttccagccggggagttctcggagccatttgtacacttcatcactcaatgc
atgagaaagcaaccaaaggaaagaccagcacctgaagatttaatgggccaccccttcatc
gtgcagtacaacgacggccatgcagaggtggtgtccatgtgggtgtgcaggacgttggag
gagcggcgctcagcccagggcgcaccgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system