KEGG   Gallus gallus (chicken): 415573Help
Entry
415573            CDS       T01006                                 

Gene name
EIF3J, EIF3S1, eIF3-alpha, eIF3-p35
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit J
  KO
K03245  translation initiation factor 3 subunit J
Organism
gga  Gallus gallus (chicken)
Pathway
gga03013  RNA transport
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    415573 (EIF3J)
Ribosome biogenesis [BR:gga03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    415573 (EIF3J)
Translation factors [BR:gga03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    415573 (EIF3J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_subunit YL1 Nop53 BRICHOS
Motif
Other DBs
NCBI-GeneID: 415573
NCBI-ProteinID: NP_001012789
CGNC: 6209
Ensembl: ENSGALG00000008187
UniProt: Q5ZKA4
Position
10
AA seq 252 aa AA seqDB search
MAAEADSWDADTFEVVEPVAKRLVPAGVAGDRWAGEDEEDDVKDNWDDEEEEEEVKEAEV
KQEPKVSEKKKIAEKIKEKEKQQKKKQEELKKRLEAPEEHKELTPEEQLADKLRLKKLQE
ESDLELAKETFGVNNACGIDAMNPSSKDDFTEFGKLLKEKITQYEKSLHYASFLEALVRD
VCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGY
DGEYVQEFEDFM
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggaggcggattcctgggacgccgacaccttcgaggtggtggagccggtggcg
aagcgtttggtgccggcgggggtggccggcgaccgctgggccggcgaggacgaggaggac
gacgtgaaggataactgggatgatgaggaggaagaggaggaagtaaaggaggcggaggtg
aaacaagaacccaaagtgtcagaaaaaaagaaaatagcagaaaagataaaagaaaaagaa
aagcaacagaagaaaaagcaagaggagcttaaaaaaaggttagaggctccagaggaacat
aaagaacttacaccagaagaacagttagcagacaaactacgactaaagaaattgcaagag
gagtcagaccttgagttagcaaaagaaacgtttggtgtaaataacgcttgtggaatagat
gccatgaacccctcctcaaaagatgacttcacggaatttggcaaactactaaaagagaaa
atcacacagtatgagaagtccttacattacgccagctttttggaagcgttagttcgagat
gtttgtatttcattggaaattgatgatttgaaaaagatcacgaattcgttgacggtacta
tgcagtgaaaaacagaaacaggagaagcagagtaaagccaaaaagaagaaaaaaggtgtt
gtgcccggaggtggtttaaaggctactatgaaagatgacctggctgattatggaggatat
gacggagaatacgtacaagagtttgaagacttcatgtga

DBGET integrated database retrieval system