KEGG   Gallus gallus (chicken): 415578Help
Entry
415578            CDS       T01006                                 

Gene name
RASGRF1
Definition
Ras protein-specific guanine nucleotide-releasing factor 1
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    415578 (RASGRF1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    415578 (RASGRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
10
AA seq 1256 aa AA seqDB search
MQKGMRLNDGHVTYLGLLAKKDGARKGYLSKRSSDNTKWHTKWFALLQNMLFYFETDSSS
RPSGLYLLEGCVCDRAPSPKPSLSAKDSLEKQHYFTVNFNHENQKTLELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEIAS
LLKDHERIQSVQSSAPSDDDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLRKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLIEEQESTDEDAKASG
QDIDHLDFKIVVEPKDASSFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNT
FLHSYRVFTTALVVLDKLITIYKKPISAIPARSLELLFASSQNTKLLYGEPPKSPRANRK
FSSPPPLSITKSSSPSRRRKLSLNIPIITGGKALDLAALSCSSNGYASMYSSMGPFSKTT
LDINKLYVSSSYPNKIPDEGEAAAEKQEEVLSSKQSSDVSVREESDTDPNQSDEAEAETS
PTKSPTTPMSIKCKNSSDFSLFSYNNGVVMPSCRELDSTRSALSAASAFAIATAGANEGT
PTKEKYRRMSLASAGFPTDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNEELKF
RVISFLEEVIHDPELLTQERKAAANIIRTLTQEDPGDNQTTLEEVVQMAEGVKAEPFENH
SALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKNTKHFNDVSNLIASEI
LRNEELTARVSAIEKWVAVADICRCLHNYNAVLEITSSLNRSAIFRLKKTWLKVSKQTKA
LIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFSK
MRMISHIIREIRQFQQTSYKIEHQPKVTQYLLDQSGVMDEEALYGASLRMEPKLPS
NT seq 3771 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggggatgcggctcaatgacgggcacgtcacctacctggggctgctggcgaag
aaggacggcgccaggaagggctatctgagcaagcggagctccgacaacacaaaatggcac
accaagtggttcgcgctgctgcagaacatgctcttctacttcgagaccgactccagctcc
cggccctcggggctctacctgctggagggctgcgtctgcgaccgggcgccctcccccaag
ccctccctctcggccaaggactccctggagaagcagcattacttcaccgtgaacttcaac
catgagaaccagaagacgctggagctgcgcaccgaggatgccaaggactgtgacgagtgg
gtggcggccattgcccacgccagctacaggaccctggccacggagcacgaggcgctgatg
cagaagtacctccatttacttcagatcgtggaaacagagaaaactgttgccaagcaactc
cgacaacagattgaggatggggagatcgagatcgagcggctgaaggcggagattgcttcc
ctgctgaaggaccatgagcgcatccagtcggtgcagagcagcgcgcccagcgacgacgac
agcgacatcaagaaaatcaagaaggtgcagagcttcctgcgcggctggctgtgccgcagg
aagtggaagaccatcatccaggactacatcaggtccccgcacgccgacagcatgcgcaag
aggaaccaggtggtgttcagcatgctggaggctgaggctgaatacgtgcagcagctgcac
atcctggtcaacaacttcctgcggccgctgcgcatggctgccagctccaagaagccgccc
atcacgcacgacgatgtcagcagcatcttcctcaacagcgaaacaatcatgtttttgcac
caaatcttttaccaaggcctgaaagcgaggatatccagctggccgacgctcgtgctggct
gacctctttgacatcctgctgcccatgctgaacatctaccaggagtttgtgcggaaccac
caatacagcctgcagatcctggcgcactgcaagcagaaccgtgacttcgacaagctgctg
aagcactacgaggccaagcccgactgcgaggagcgcacgctggagaccttcctcacctac
cccatgttccagatcccccggtacatcctgacgctgcacgagctgctggcacacaccccg
catgagcacgtggagaggaacagcctggattacgccaagtccaagctggaggagctctcc
aggataatgcacgatgaagtgagtgagactgaaaacatccgaaaaaatctggcgatagaa
cggatgatcattgagggctgtgagattctgctggacaccagccagacctttgtacgacaa
gggtccctcatccaagtgccgatgtcggagaaggggaagatcacacgcgggcggctgggc
tccttgtcactgcgcaaggagggcgagcggcagtgcttcctcttctccaagcacctgatc
atctgcacgcgcggctctggcggcaagctgcacctcaccaagaatggcgtcatctccctc
atcgactgcacgctgattgaggagcaggagagcaccgatgaggacgcgaaagcttcaggg
caggacatcgaccatctcgacttcaagattgtggtggagccaaaggacgcctcgtccttc
accgtcatcctcgtggcatcctccaggcaggagaaggctgcctggaccagcgacatcagc
cagtgcgtggacaacatccgctgcaatgggctcatgatgaatgccttcgaggagaactcc
aaggtcaccgtgccgcagatgatcaagtctgatgccagcttgtattgtgatgatgttgac
attaggttcagtaaaacgatgaattcctgcaaggtcctccagatccgctatgcaagcgtg
gaacggctgctggagcggctgacggacctgcgcttcctgagcatcgacttcctgaacacg
ttcctgcactcgtaccgcgtcttcaccaccgccctggtcgttcttgacaagctcatcacc
atctacaagaaacccatcagcgccatccctgcgcggtccctggagctgctgtttgccagc
agccagaacaccaagctgctctacggggagccccccaagtccccccgcgccaaccgcaag
ttctcctcgccgccaccactctccatcaccaaatcgtcgtcccccagccggcgcaggaag
ctctccctcaacatccccatcatcactgggggcaaggcgctggacctggcggcactcagc
tgctcctccaacggctatgcaagcatgtactcctccatgggccccttcagcaagaccacc
ctggacatcaacaagctgtacgtgtccagcagctaccccaacaagatccctgatgaaggg
gaagcggccgcagagaaacaggaggaggtgctgtcaagcaagcagagttcagacgtgtcc
gtccgggaggagtccgacaccgaccccaaccagagcgatgaggcggaggctgaaacttcc
ccgacaaaatctccgaccactcccatgtccatcaagtgcaagaactcctcggatttctcc
ctgttctcctacaacaatggtgtggtgatgccgtcctgccgggagctggacagcacccgc
agcgccctgtctgccgcctccgccttcgccatcgccacggcgggcgccaacgaggggacc
cccaccaaggagaagtaccggcgcatgtcgctggccagcgcaggcttcccgaccgaccag
cggaacggggacaaggagttcgtcatccggagagcagccaccaacagggtcctcaacgtg
ctgcggcactgggtctccaagcactcgcaggactttgaaaccaacgaggagctgaagttc
agggtgatcagctttctggaggaggtgattcacgaccctgagctcctgacccaggagagg
aaagcagctgcaaacatcatcagaactctgacacaggaggacccgggggacaaccagacc
acgctggaggaagtggtgcagatggctgagggagtcaaagcagagccctttgagaatcac
tcggcgctggagatagcagaacagctgacgctgctcgaccacctggtcttcaagaagatc
ccctacgaggagttcttcgggcagggctggatgaagctggagaagaacgagcggacgccg
tacatcatgaagaacacgaagcacttcaatgatgtcagcaacttgattgcgtccgagatc
ctccgcaacgaggagctcaccgcgcgcgtcagcgccatcgagaagtgggtggcggtggcc
gatatctgccgctgcctgcacaactacaacgccgtgctggagatcacctcctccctcaac
cgcagcgcgatcttccgcctgaagaaaacctggctgaaggtctccaagcagacaaaggct
ctgatcgacaagttgcagaagctggtgtcctcggagggcaggttcaagaatctgagggag
gcgctgaaaaactgcgaccccccgtgcgtgccctacctgggcatgtacctgaccgacctg
gccttcatcgaggagggcacccccaactacactgaggatgggctggtgaacttctccaaa
atgaggatgatttcccacatcatcagagagatccgccagttccagcagacctcctacaag
atcgagcaccagcccaaggtgacgcagtacctgctggaccagtccggagtgatggacgag
gaggctctgtacggggcttccctgcggatggagcccaagctgccttcctga

DBGET integrated database retrieval system