KEGG   Gallus gallus (chicken): 415746Help
Entry
415746            CDS       T01006                                 

Gene name
GPT2
Definition
(RefSeq) glutamic pyruvate transaminase (alanine aminotransferase) 2
  KO
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
gga  Gallus gallus (chicken)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    415746 (GPT2)
   01210 2-Oxocarboxylic acid metabolism
    415746 (GPT2)
   01230 Biosynthesis of amino acids
    415746 (GPT2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    415746 (GPT2)
   00220 Arginine biosynthesis
    415746 (GPT2)
Enzymes [BR:gga01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     415746 (GPT2)
Amino acid related enzymes [BR:gga01007]
 Aminotransferase (transaminase)
  Class I
   415746 (GPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
11
AA seq 544 aa AA seqDB search
MHRFVSAAGRAAGRVPASCRGAGEEALRGAAGRPPRGARLPPEGTARWSSAAKASAVKIN
EKASREKILTLESMNPQVKAVEYAVRGPIVHKAGEIEKELRKGIKKPFTEVIKANIGDAH
AMGQRPITFLRQVVALCTYPNLLDSPSFPEDAKKRARRILQGCGGNSLGAYTASQGINCI
REDVASYIERRDGGVPADPDNIYLTTGASDGITSILKILVSGGGKSRTGVMIPIPQYPLY
SAVISELDAIQVNYYLDEENCWSLDVNELRRSLNEAKAYCNPKVLCIINPGNPTGQVQSR
KCIEDVIHFAWEEKLFLLADEVYQDNVYSEGCQFHSFKKVLYEMGPEYSNNVELASFHST
SKGYMGECGYRGGYMEVLNLHPDIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVPGEESY
SQFIKEKESVLNNLAKKAKLAEDMFNKVPGVHCNPLQGALYAFPRIFIPSKAIEEAKAHK
MAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPQIDKLKILMEKMKDFHIKFL
EKYA
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcttcgtgtcggcggcggggcgcgccgcgggccgggtgccggcgagctgccgg
ggcgccggggaagaggcgctgcgcggcgcggcggggcggcccccgcggggtgcccggctg
ccgccggagggaacggcgagatggagcagcgctgccaaggcctccgccgtgaagatcaac
gagaaggcgagcagggagaagatcctgactctggaatccatgaacccgcaagtgaaggcg
gtagaatacgccgtgcggggccccatcgtccacaaagccggcgagatcgagaaggagctg
cggaagggaatcaaaaaaccttttactgaagtaattaaagccaacattggagatgcgcac
gcaatgggacagaggccaatcaccttccttcgtcaggtagtggcactgtgcacataccca
aacctgttggacagcccaagttttccagaagatgcaaaaaagcgagcgagacggatcttg
cagggttgtggaggtaacagcttaggagcttacactgccagccaaggtataaactgcatc
cgcgaagatgtcgcttcatatattgaaagaagagatggaggagttcctgcagatccagat
aacatatatcttaccactggggcaagcgatggtattacttcaattttaaagatcctggtc
tcaggaggtggaaaatcccgaacaggagtgatgatccctataccacaatatcccttgtat
tcagcagtcatatctgaactagatgccatccaggtgaactactacttggatgaagaaaac
tgctggtctctagatgtaaatgaacttcggcgctccttgaatgaagccaaggcatactgc
aatccaaaagtgctctgcatcatcaacccaggaaatcccacaggacaggtacaaagcagg
aagtgcattgaagatgtgatacactttgcttgggaagagaaactttttcttctggctgat
gaggtttaccaggacaatgtgtactctgaaggatgccagtttcattcattcaaaaaggtt
ctgtatgagatgggacccgagtactctaacaacgttgagctggcctcttttcattccacc
tctaagggatatatgggcgaatgtggctacagaggaggttatatggaggtccttaacttg
cacccagacattaaaggacagcttgttaagctgctttctgttcgcctttgtcctccagtc
tcaggacaagcagcaatggatattgtagtgaatcccccagtacctggagaagaatcttat
tcccagttcataaaggaaaaggagtctgtcttgaacaatcttgccaaaaaagccaaactg
gcagaagacatgttcaacaaggttccaggagttcactgcaatccgcttcagggtgctttg
tatgctttcccacggatctttataccttccaaagccattgaggaagcaaaggctcataaa
atggcacctgacatgttctattgcatgaaacttttggaagagactggaatctgtgttgta
cctggaagcggatttggccaaagagaaggaacctatcatttcagaatgaccattcttcct
caaatagacaagctgaagatcctaatggagaaaatgaaagacttccacataaagtttctt
gaaaaatatgcatga

DBGET integrated database retrieval system