KEGG   Gallus gallus (chicken): 415786Help
Entry
415786            CDS       T01006                                 

Gene name
CES1
Definition
(RefSeq) carboxylesterase 1 (monocyte/macrophage serine esterase 1)
  KO
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    415786 (CES1)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     415786 (CES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
11
AA seq 574 aa AA seqDB search
MATEKNTLLSLILTAGITALVATGQKAEQPEVVTKYGTARGYQFKVDAAERSVNVFLGLP
FAKAPVGPLRFSEPQPPEPWKGVRDATSYPPMCLQDKVLGQFLSDVFTNRKEKVRLQMSE
DCLYLNIYTPVSTEKQEKLPVFVWIHGGGLVLGAASSYDGSALAAFDNVVVVTIQYRLGI
AGYFSTGDKYARGNWGYLDQVAALQWIQENIIHFGGDPGSVTICGESAGGISVSALVLSP
LAKGLFHKAISESGTAIRTLFTDKPEEEAQRIAAASGCEKSSSAALVECLREKTEEEMEQ
ITLKMEMTTLKVCYTSPGKCEQPSMFISSTVDGVFFPKSPRELLSEKAINAVPYIIGVNN
CEFGWVIPEMMKVPDFTEGLDKEVARQVLQSSFVLSFKSVPSDIVDLVFNEYIGKAESRA
QVRDGLLDAIGDHMFVFPAIEVARYHRDAGHPVYFYEFQHRPSSATGVVPEFVKADHGDE
IAFVFGKPFLAGNATEEENKLSRAVMKYWTNFARYGNPNGEGLVHWPQYDLDERYLEIDL
IQKAAKKLKEDKMEFWVQLTEQMRSERRRERTDL
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgaaaagaacacgctgctgtccttgattctcaccgccgggatcacggctctc
gtagcgactgggcaaaaagcagagcaaccagaagtggtgaccaaatacgggactgcccga
ggataccaattcaaagtagatgcggctgagaggagtgtaaatgtctttctgggacttcct
tttgctaaggctcctgttggaccactgaggttttctgaaccccagccacctgagccatgg
aaaggtgtcagagatgccacttcctacccaccaatgtgtctacaggacaaagtattagga
cagtttctgtcagatgtttttactaatagaaaggaaaaagttcgtctccagatgtctgaa
gattgcttatacctgaatatttacacacctgtttctacagaaaaacaggagaagctgcct
gtctttgtgtggatccatggaggtggattagttctaggagcagcatcatcctatgatggt
tcagcattagcagcctttgacaacgtggttgttgtgacaattcaatacagattgggtatt
gctggatactttagcactggtgataagtatgctcgtggtaactgggggtatttggaccaa
gtggcagctcttcagtggattcaggaaaatatcatacactttggaggagacccaggatct
gtcaccatctgtggagaatctgcagggggaatcagtgtatctgctctggtcttatctcca
ctggcaaaaggcttgttccataaggccatttcagagagtggtactgcaatcaggacttta
ttcactgataagcctgaggaagaagcacaaagaattgctgctgcatctggctgtgaaaag
tccagttccgctgctctggttgagtgcttgagagaaaaaacagaggaagagatggaacag
ataactctaaaaatggaaatgacaactctgaaagtatgctatacgtcacctgggaaatgt
gaacagccttccatgttcatcagttcaactgtggatggtgtattttttccaaagagcccc
agggaattgctgtctgaaaaagcaatcaatgcagtcccatatataataggagtgaataac
tgtgaatttggatgggtaattcctgaaatgatgaaagttcctgattttacagaaggtctg
gacaaagaagttgcacgtcaagtattacagagctcatttgtattatcatttaagagcgtt
ccatctgacattgtagatctcgtattcaatgaatacatagggaaagcagagagccgtgct
caggtgcgagatggccttcttgatgcaataggggatcacatgtttgttttcccagccatt
gaagtggctagataccatagagatgctggccacccagtctacttttatgaatttcaacat
cggccaagctcagccacgggtgtcgtaccagagtttgtaaaagcagatcatggagatgag
attgcctttgtctttggaaagccgttcttagcagggaatgctacagaagaagaaaataaa
cttagcagagctgttatgaaatactggactaactttgctagatacggaaatcccaatggg
gaaggcttggtccattggcctcagtatgatctggatgaaagatacctggaaatagacctc
atccaaaaggcagcaaagaaactgaaagaagacaaaatggagttttgggtacagctcaca
gaacaaatgaggagtgaaaggaggagagaacgcacagatttgtga

DBGET integrated database retrieval system