KEGG   Gallus gallus (chicken): 415812Help
Entry
415812            CDS       T01006                                 

Gene name
MLYCD
Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
gga  Gallus gallus (chicken)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gga00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:gga00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:gga04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
11
AA seq 609 aa AA seqDB search
MVVTGEKDPGITGLHSERLKERALRTIKALRKEGQPTAPVKEQPNSAFSRPPHSRWRRSA
SHAAPHSPALPLLSSDWRVRGASQSARPLPLRGRCRGLAQLEAAAGGGMSRLVPCLRSRL
LLCECRAVSRGLLRVSLAAGPCRGTAGCGAASDVSMEELLSRSVPPLPPYETKEKAPPPA
ELRGAEFVRYYRGLPAGPPRAELLTRLARDFGVDHGRVAEFSAKVLQAREQQRELGALLQ
AEDRLRYYLNPRYRGLFQHLGRLEGGLRFLVELRGDLVEGLASKAVDGPHVKEMSGVLKN
MLSEWFSTGFLNLERVTWQSPCEVLQKISDSEAVHPVRNWVDMKRRVGSYRRCYFFSHCA
IPGEPLIVLHVALTSDISSSIQAIVKEVEPLETEDADKITTAIFYSISLTQQGLQGVELG
TYLIKRVVKELQKELPQIKTFSTLSPIPGFTKWLVGLLSSQTKELEKNELFTESERQELS
QITGDCTTETLKKLLNNNEWVRSEKLVNALHSPLMRLCAWYLYGEKHRGYALNPVANFHL
QNGSVLWRINWMADTSPRGIAAACGMMVNYRYFLEDTASNSAAYLGTKAIKASEQVLSLV
SQFQQNSKL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggtagtgacaggtgagaaagatccaggaatcactgggttgcacagcgaacgcttgaag
gaacgtgcactgaggacgataaaagctttgcgcaaggaaggacagccaacagcgcctgtg
aaggaacaacccaacagcgcgttttcgcgcccgccacactcaagatggcggcgcagcgct
agtcacgccgcgccacactctcctgcacttccccttctctcttctgattggcgggtccgc
ggtgccagccaatcagcgcgcccgctgccgctccgagggcggtgccgcggcctggcccag
ctggaagccgcggctggtggcgggatgagccgtctcgttccgtgcttgcgctcacggctc
ctcctgtgcgagtgccgggcggtgtcgcgggggctgctccgtgtctcgctggcggccggc
ccgtgtcggggcacggcgggctgcggtgccgcctccgacgtaagcatggaggagctgctg
agccgctccgtgccgccgctgccgccctacgagaccaaggagaaggcgccgcccccggcg
gagctgcgcggcgcggagttcgtgcggtactaccgcggccttccggccgggccgccccgc
gctgagctcctcacccgcctggcccgcgacttcggcgtggaccacgggcgggtggcggag
ttcagcgccaaagtgttgcaggcccgggagcagcagagggagctgggagccctgctgcag
gccgaggaccggctgcgctactatctgaacccgcggtaccgggggctgttccagcacctg
ggtcgcctggagggcggactgcgcttcctggtggagctgaggggagacctggtggagggg
ctggcgagcaaggcggtggatgggcctcacgtcaaggaaatgagtggtgttctaaagaac
atgctctcagagtggttttcaacaggattcctaaatttggagcgggtgacgtggcagtca
ccttgtgaagtactccagaaaatcagtgattctgaagctgtgcatcctgttagaaactgg
gttgatatgaagcgtcgagtggggtcatatagaagatgctactttttttctcactgtgca
atcccaggagaaccgttgatagtcttgcatgttgcattaaccagtgatatctccagcagc
atccaggccatagtgaaagaagtggagcctttagaaacagaagatgcagacaaaattaca
acagcaattttctactcaatcagtttgactcagcaaggactgcagggagtggaacttggg
acttacctcatcaaacgtgtggtaaaggagctgcagaaagaacttcctcagataaaaact
ttctccactctgtcgcctatccctggcttcacaaagtggctcgtcggtctcctctcctca
cagacaaaagaactggaaaagaacgaactttttacagaatcagaacgccaggaactatct
cagatcacaggcgactgtactactgaaacactaaagaagctcttaaataacaacgaatgg
gtacgatcagaaaaattagtcaacgcgctccattcaccgcttatgagactgtgtgcctgg
tatttgtatggggagaaacaccgtggctatgcgctgaacccagtagcaaactttcacctt
cagaatggctccgtgttgtggcggataaactggatggcagacacaagccctcggggcatt
gctgctgcctgtggcatgatggtgaactaccggtacttcttggaggatacagccagtaac
agtgcagcctacctggggacaaaagccattaaagcctcagagcaggttctttccttggtg
tcgcagttccagcagaacagcaagctttaa

DBGET integrated database retrieval system