KEGG   Gallus gallus (chicken): 415817Help
Entry
415817            CDS       T01006                                 

Gene name
USP10
Definition
ubiquitin specific peptidase 10 (EC:3.4.19.12)
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
11
AA seq 785 aa AA seqDB search
MAVNGAQYIFGEFSPDEFNQFFVTPRCSVELPPYNETVSCGIKSTNEEYQRIEFGVNEVI
ETESSVLNNTDYSISSTLNPQAPEFILSCAPAQKTPDETNYNSIDCQFSDPTLTLDSGSN
AENDGLSGGLGQRERKKKKKRPPGYYSYLEDVSDGVAPTEALVNGHANSSGLNSIGTEDT
ELTGDIPSLATPRTCNSPDNSVDFVHEAVSDDSVSSALDNTRTAGQPEVCRVTNSEQFCI
PSETGRDSPLRTAVVQPYAGTDTTESLGVTNGQTLESSGEDTAANGVELHTVESTDSDQA
KPEEASPTTEATATVAGSVPVNQPAKSWASLFHNSKPSASTSVVYVETKYTPPATSTLVP
EKQVEVKEGPVPVSEDPVAIKIAELLENVKLVHKPVSLQPRGLINKGNWCYINATLQALV
ACPPMYHLMKSIPMYSKSQRPCTSTPMIDSFVRLMNEFTNMPVPPKAKQALGDKIVRDIR
PGAAFEPTYIYRLLTVIKSSLSEKGRQEDAEEYLGFILNGLHEEMLTLKKLLSPHNEKLS
VSNGPEVQTVREEEEQDEQGEGSEDEWEQVGPRNKSSVTRQADFVQTPITDIFGGHIRSV
VYQQSSKESATLQPFFTLQLDIQSDKIRTVQDALESLVARESVQGYTTKTKQEVEISRRV
TLEELPPVLVLHLKRFVYEKTGGCQKLIKNIEYPVDLEISKELLSPGVKSKIFKGQRTYR
LFAVVYHHGNSATGDHYTTDVFQIGLNGWLRIDDQAVKVINQYQVVKPSAERTAYLLYYR
RVDLL
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgaacggcgcccagtacatttttggggagttcagccctgatgagttcaatcag
ttctttgtgactccacgttgctctgttgagcttcccccttataatgaaacggtttcatgt
ggcattaagtccacaaacgaggagtatcagagaattgaatttggtgttaatgaagttatt
gagacggagtcttctgtactaaataacaccgactacagtatttcaagcactctgaatcct
caggctccagaattcattctcagctgtgcacctgctcagaaaacccctgatgaaacaaac
tacaactcaattgactgccagttctctgacccaaccctcactctggatagtggttctaat
gctgaaaatgacggcttgtctggaggccttggacagagggagcgtaaaaagaagaaaaaa
agaccccctggatactacagttatttggaagatgtcagtgatggcgtggctcccacagaa
gctcttgtaaatggccacgcaaattcctcgggacttaacagtattggcacggaggatacg
gaactgacgggggacatcccctctctggccacaccaaggacttgcaacagcccggacaat
tctgtggacttcgttcatgaagctgtttctgatgattctgtttctagcgcactagacaat
accaggactgcagggcagcctgaggtatgcagggttactaattctgaacagttttgcatc
ccctcagagactggcagagatagccctttaaggacagctgttgtacagccttatgctggt
actgatactactgaaagtcttggcgttactaatggacaaacacttgaatcctctggtgag
gacacagctgccaatggggtagaattgcacactgtggaaagcactgactcagaccaagct
aagcctgaggaagcttcacctactactgaggcaacagccacggttgcaggatcagtccct
gttaatcagcctgcgaaatcgtgggctagtctttttcacaattccaagccctctgcttcc
acatctgtggtctatgttgagactaagtatacccctcctgccacatctactctggtccct
gaaaaacaggttgaagtcaaagaggggcctgttccagtttcagaggatcctgtagccata
aagattgcagaattactggaaaatgtaaaactagtacataaaccagtgtctttgcaacct
cgggggctgatcaacaaaggaaactggtgctacatcaatgctaccctgcaagccttggtt
gcttgccctccaatgtatcatttaatgaagtccattccaatgtattcaaaatcacagcgg
ccgtgtacgtcgacaccaatgatagacagttttgttcgtttaatgaatgagttcactaat
atgcctgtacctcctaaagcaaaacaagctttaggtgataaaattgtgagggatatccga
ccaggagctgcctttgaacctacgtatatttacagacttctgacagttatcaagtcaagt
ctgtcagagaagggcagacaagaggatgctgaagaatacttgggatttattctcaatgga
ctacatgaagaaatgttgaccctaaagaaacttctctctccacataatgaaaaactctct
gtttccaatggtcctgaggttcagactgttcgtgaggaagaggagcaagatgagcaagga
gaaggcagtgaggatgaatgggagcaagtgggacctcgcaacaaatcctcagtcactcga
caggctgactttgttcagactccaataactgatatttttggtggtcacataaggtctgtt
gtttaccagcagagttctaaagaatctgctacgctgcaacctttcttcaccctgcaactg
gatatccagtctgacaagatacgcaccgtccaggatgcattggaaagtttggtggcaaga
gagtctgtccagggttataccacaaaaaccaagcaagaggtggagataagtcgaagagtg
acactagaagagctcccccctgtccttgttttacacctcaagaggttcgtgtatgagaag
actggtggatgtcagaagcttatcaagaatatcgagtatcctgttgatctggaaattagt
aaagagctactatctcctggtgtgaaaagtaagattttcaaaggccaaagaacctaccgg
ctctttgcagttgtttatcatcatggaaacagcgcaactggtgaccattacactacagac
gtcttccaaatcgggctcaatggctggttacgcatcgatgaccaggcagtgaaggtgatc
aatcagtaccaggtggtgaagccgtctgcagaacgcacagcctacctcctgtactaccgc
cgagttgacctgctgtga

DBGET integrated database retrieval system