KEGG   Gallus gallus (chicken): 415937Help
Entry
415937            CDS       T01006                                 

Gene name
USP4
Definition
ubiquitin specific peptidase 4 (proto-oncogene) (EC:3.1.2.15)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     415937 (USP4)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   415937 (USP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
12
AA seq 964 aa AA seqDB search
MAAAQGGGGTARPELGPEALGSATVEPAAVDAAAPNPAVQRAELRPLMAASMRLGESWYL
LASRWFSLWKRYVGYDRWDVSGVGDPNLFPGPIDNSCLLGDGETQSLKEHLIAQLDYVLV
PSSAWQKLVSWYGCIEGQQPIVRKVMEFGLYAKHCEVEVYPLELKLCESSSPSNVISCCF
SRRDSVATLVKEVRKLFKIPAEKDVRLWSSHFDGSYEQLSELGVTLEDANIYHGALVLIE
VKNEDGTWPQHPFLAKSSTATSRNFTTSSKPSASSYSTASATSVITNGDSSNSYGLSSSS
LGRGGSGFACNSYSSRDSASLSQPGLCGLSNLGNTCFMNSALQCLSNTPPLTDYFLEDKY
EAEINHSNPLGMRGEIAEAYAELIKQIWSGRQSHVAPRMFKTQVGRFAPQFSGYQQQDSQ
ELLAFLLDGLHEDLNRVKKKPYLELKDANGRPDSVVAKEAWENHRLRNDSIIVDIFHGLF
KSTLVCPKCSKVSVTFDPFCYLTLPLPLKRDRLLEVTLVYADPQRRPVQYRVVVPMMGAI
SDLCESLSKLSGVPAENMVVTDVYNHRFHKIFQADEALNHIMPKDDIFVYEVCKPSEDGS
EYITFSVYFREKAARQSSSTAGTVLFGQPLLISVPKHKLTVDHLYSVVLERISRYVKLPV
AEEYSAPCPDRGACNGSSSVAEGDIEEMEHQDDGQEGREKLAEVDPCPSEGCMQIEPTRD
LQPCKKQHFTFSLVNLYGTSEINSIVEGKLLKLSAFSTLAIDWDSGTRRLLFDEQEAQAF
EKHASVLQPQKMKAVVALKDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKI
LVVHLKRFSYSRYWRDKLDTVVEFPIRGLNMSEFVCDPRGGSYVYDLIAVSNHYGAMGVG
HYTAYAKNKVNGEWYYFDDSSVSLASEDQIVTKAAYVLFYQRRDNEEHVAPSPPQEECDG
MDTN
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcccagggcggcggtgggacggcgcggccggagctcggcccagaggcgctg
ggctcggcgaccgtggagccggcggcggtggacgcggcggcgccgaacccggcggtgcag
cgggccgagctgaggccgctgatggccgcgtccatgaggctgggggagtcgtggtacctg
ctggccagccgctggttcagcctctggaagcgctacgtgggttacgacaggtgggacgtg
tccggagtgggcgaccccaacctcttccccgggcccatcgacaactcgtgtctgctcggc
gatggggaaactcagagcttaaaggagcacctcatcgcccagctggactacgtgctggtg
cccagcagcgcctggcagaagctggtttcgtggtatggctgcatcgagggacagcaaccc
atcgtgaggaaagtgatggaatttggtctgtatgcgaagcactgtgaagttgaagtttat
cctcttgagctgaagctgtgtgagagcagcagtccttccaatgtgatcagctgctgcttc
agcagaagagatagcgttgccactcttgtgaaggaggtacggaaactatttaaaatccca
gctgagaaggatgtgaggttatggagcagccattttgatggctcttacgagcagctcagc
gagctgggtgtcactctggaagatgcaaacatctaccatggggcgcttgtcctaatagag
gtgaaaaatgaagatggcacgtggcctcaacatcctttccttgcaaagtcaagcactgca
actagcagaaactttactacctcttcaaaaccgtcagcaagttcttactccacagcatct
gccacgtctgtcattactaacggtgatagcagtaactcctatggactgagcagctccagc
ctgggcaggggaggttctggatttgcctgcaactcttatagcagcagggactctgcttcc
ctgtcccaacctggcctttgtggactcagtaaccttgggaatacctgcttcatgaattct
gcattacagtgtctgagcaatacccctcctctgactgactatttcctggaagataaatat
gaagctgaaataaatcacagcaaccccttggggatgagaggagaaattgcagaagcctat
gcagaactcattaaacagatctggtctgggagacaatctcatgtggccccacgtatgttt
aaaacacaggttggccggtttgctcctcagttttcaggataccagcagcaagattcccag
gagctcttggcttttcttctagatggcttgcatgaggatttgaacagagtgaagaagaaa
ccttacttggagctgaaggatgccaatggcaggcccgattccgtggtagcaaaagaagcc
tgggagaaccacagactgagaaacgattctatcattgtggatatttttcatggtcttttc
aagtctacccttgtttgtcccaaatgctccaaggtttctgtgacctttgatcccttctgt
tacttaacccttccactgcctttgaagagagatcgtctcctggaagtgaccctggtatat
gcagacccacagcgcagacctgtccagtaccgggtcgtggtgccaatgatgggggccatc
tcagatctctgcgaatcactctccaaactttccggggttcctgcagaaaacatggtggtg
acagacgtgtataaccatcggttccacaaaatcttccaagcagatgaagctttaaatcat
atcatgccaaaagacgacatctttgtatatgaagtctgcaagccaagtgaagatggctca
gagtacattactttctctgtttactttcgggaaaaggcagcgaggcaatccagcagcact
gcagggactgtgctctttggtcaaccactgctgatatctgtgccaaaacacaagctcact
gtggatcacttgtacagtgtcgttttggagcggatcagtcgctatgtgaaactccctgtg
gcagaagaatactctgcaccttgcccggacagaggagcatgcaatggctccagcagtgtg
gctgaaggagacattgaagagatggagcatcaggatgatggacaggaaggcagggagaag
ctggcagaagttgatccctgcccctctgagggctgcatgcagattgagccaacgagagac
ctgcagccttgtaagaagcagcatttcacttttagccttgtgaatttatacgggacctct
gagataaactccattgtagaaggaaaactcttgaaattgagtgctttttctacacttgct
attgactgggattctggtacacgcaggctgctctttgatgaacaggaggcacaggcattt
gaaaagcatgcaagtgtgttacaaccgcagaagatgaaggcagtggtagcccttaaagac
tgcatagagctctttactacaatggaaactcttggtgaacacgacccttggtattgccct
aactgtaagaagcatcagcaggccacgaagaagtttgacttgtggtctttgcccaagatt
ttggtagtgcatctaaaacgcttctcatacagcagatactggagggataaacttgacact
gttgttgaattccctatcaggggtttaaacatgtctgagttcgtctgtgacccaagagga
ggttcatatgtctacgacctcattgcagtttccaatcactatggagccatgggagtaggc
cactacactgcctatgcaaagaacaaggtgaatggcgagtggtactactttgatgacagc
agtgtatcattggcttcagaagaccaaatagtgacgaaagctgcctatgtgctgttttat
cagcgccgagacaatgaggaacatgttgccccatctcctccccaagaagagtgtgacggc
atggataccaactaa

DBGET integrated database retrieval system