KEGG   Gallus gallus (chicken): 415991Help
Entry
415991            CDS       T01006                                 

Gene name
TKT, TKTL1
Definition
(RefSeq) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00030  Pentose phosphate pathway
gga01100  Metabolic pathways
gga01200  Carbon metabolism
gga01230  Biosynthesis of amino acids
Module
gga_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
gga_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    415991 (TKT)
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    415991 (TKT)
Enzymes [BR:gga01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     415991 (TKT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh TPP_enzyme_C DXP_synthase_N XFP_N
Motif
Other DBs
NCBI-GeneID: 415991
NCBI-ProteinID: XP_414333
CGNC: 3953
Ensembl: ENSGALG00000005309
UniProt: F1P1A5
Position
12
AA seq 627 aa AA seqDB search
MEDYHKPDQQTLQALKDTANRLRIGSIKATTAAGSGHPTSCCSAAEIMSVLFFHTMRYKV
QDPRNANNDRFVLSKGHAAPVLYSAWAEAGFLQEAELLNLRKIDSVLEGHPVPRQAFTDV
ATGSLGQGLGAACGMAYTGKFFDRASYRVYCLLGDGELSEGSVWEAMAFAGFYKLDNLVA
IFDVNRLGQSDPAPLQHHVEIYQKRCEAFGWHAIIVDGHSVEELCKAFGQAKHQPTAIIA
KTFKGKGISGVEDKESWHGKPLPKNMAEQVIQEIDEKIQNKKKLSPALPEEDAPVVNIRN
IKMPSPPSYKVGEKWATRKAYGLALAKLGHANDRVIALDGDTKNSTFSELFKKDHPSRYI
ECYIAEQNMVSVAVGCATRDRTVAFASTFATFFTRAFDQIRMAAISESNINLCGSHCGVS
IGEDGPSQMGLEDLCMFRAIPNATVFYPSDAVATEKAVEIAANTKGICFIRTSRPENPVI
YNNNEDFHIGQAKVILKSKDDQVTVIGAGVTLHEALAAAEQLRKEKIFIRVIDPFTIKPL
DKKTILENARATKGRIITVEDHYHEGGIGEAVCAAVVGEPGVTVSRLAVSHVPRSGKSAE
LLKMFGIDKDAIVQAVKVAVSKSRNAE
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atggaggactaccacaaacccgaccagcagaccctgcaggccctgaaggacacggccaac
cggctgcgcatcggctccatcaaggccacgaccgcggccggctcgggccaccctacatca
tgttgcagcgcagcagagattatgtctgtgctgtttttccataccatgaggtataaggta
caagatcccaggaatgccaacaacgaccgttttgtgctctctaagggtcatgctgcacca
gttttatattctgcttgggcagaggctggtttcctacaagaagcagaattactgaacttg
aggaaaattgattctgtcttagaaggacatccagtaccaagacaagcattcactgatgtg
gctactggatcccttggtcagggtcttggtgctgcttgtggaatggcatacactggcaag
ttctttgacagagccagctatcgtgtgtattgtctgcttggagatggagaattatctgaa
ggctctgtttgggaggcaatggcctttgctgggttttacaagcttgataatcttgttgct
atatttgatgttaaccgtcttggacaaagtgaccctgcacctctgcagcatcatgttgaa
atctaccagaaacgttgtgaagcctttggctggcatgctatcattgttgatggtcacagc
gtggaggaactttgcaaagcctttggtcaggccaaacatcagccaacagctatcattgcg
aagacctttaaaggcaaaggcatatcaggtgttgaagataaggaaagctggcatggaaaa
ccacttccaaaaaacatggctgaacaagtaattcaggaaatagatgagaaaatccaaaac
aagaaaaagctttctcctgccctccctgaagaagatgctcctgtagtaaatatcagaaac
ataaagatgccatctccaccaagttacaaagtgggagaaaagtgggctacccgcaaagct
tatggccttgcacttgcaaaactgggccatgcaaatgatcgagtgattgctttggatgga
gacacgaagaactctactttctcagagcttttcaagaaagatcatcctagtcgctacatt
gaatgctacattgctgaacagaacatggtgagcgttgcagttggttgtgccactcgtgac
agaactgttgctttcgccagcacctttgctaccttcttcacacgggcgtttgaccagatc
cgtatggctgcaatctctgagagtaacatcaatctctgtgggtcacactgcggtgtttct
attggtgaggatgggccatctcagatgggactggaggacctgtgcatgttccgagctatt
cccaatgccaccgtcttttaccccagcgatgctgtagccactgaaaaagcagtggaaata
gctgccaacactaagggcatttgtttcataagaactagtcgtcctgaaaatcctgtcatt
tacaacaacaacgaggactttcatattggacaggcaaaggtgattctgaagagtaaggat
gaccaagtgactgtgataggagcaggagtcactctgcatgaggctctggctgcagcagag
cagctgagaaaagagaagatcttcatccgcgtgattgatcctttcactataaagcccctg
gataagaagacaatacttgaaaatgcaagagcaaccaaaggcagaatcatcactgttgag
gaccattaccatgaaggtggcattggagaagcagtgtgtgctgcagtagtgggtgagcct
ggtgtcacagtcagtcgcttggctgtatctcatgtaccacgaagcgggaagtcagctgag
ctgctgaagatgtttggtattgacaaagatgccattgtgcaagctgttaaggtggcagtg
tccaaatcaagaaatgcagagtag

DBGET integrated database retrieval system