KEGG   Gallus gallus (chicken): 415991Help
Entry
415991            CDS       T01006                                 

Gene name
TKT
Definition
transketolase
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Pentose phosphate pathway
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    415991 (TKT)
   01230 Biosynthesis of amino acids
    415991 (TKT)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    415991 (TKT)
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    415991 (TKT)
Enzymes [BR:gga01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     415991 (TKT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
12
AA seq 635 aa AA seqDB search
MEDYHKPDQQTLQALKDTANRLRIGSIKATTAAGSGHPTSCCSAAEIMSVLFFHTMRYKV
QDPRNANNDRFVLSKGHAAPVLYSAWAEAGFLQEAELLNLRKIDSVLEGHPVPRQAFTDV
ATGSLGQGLGAACGMAYTGKFFDRARLPSRWDFSYRVYCLLGDGELSEGSVWEAMAFAGF
YKLDNLVAIFDVNRLGQSDPAPLQHHVEIYQKRCEAFGWHAIIVDGHSVEELCKAFGQAK
HQPTAIIAKTFKGKGISGVEDKESWHGKPLPKNMAEQVIQEIDEKIQNKKKLSPALPEED
APVVNIRNIKMPSPPSYKVGEKWATRKAYGLALAKLGHANDRVIALDGDTKNSTFSELFK
KDHPSRYIECYIAEQNMVSVAVGCATRDRTVAFASTFATFFTRAFDQIRMAAISESNINL
CGSHCGVSIGEDGPSQMGLEDLCMFRAIPNATVFYPSDAVATEKAVEIAANTKGICFIRT
SRPENPVIYNNNEDFHIGQAKVILKSKDDQVTVIGAGVTLHEALAAAEQLRKEKIFIRVI
DPFTIKPLDKKTILENARATKGRIITVEDHYHEGGIGEAVCAAVVGEPGVTVSRLAVSHV
PRSGKSAELLKMFGIDKDAIVQAVKVAVSKSRNAE
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggaggactaccacaaacccgaccagcagaccctgcaggccctgaaggacacggccaac
cggctgcgcatcggctccatcaaggccacgaccgcggccggctcgggccaccctacatca
tgttgcagcgcagcagagattatgtctgtgctgtttttccataccatgaggtataaggta
caagatcccaggaatgccaacaacgaccgttttgtgctctctaagggtcatgctgcacca
gttttatattctgcttgggcagaggctggtttcctacaagaagcagaattactgaacttg
aggaaaattgattctgtcttagaaggacatccagtaccaagacaagcattcactgatgtg
gctactggatcccttggtcagggtcttggtgctgcttgtggaatggcatacactggcaag
ttctttgacagagccaggctgcccagcaggtgggattttagctatcgtgtgtattgtctg
cttggagatggagaattatctgaaggctctgtttgggaggcaatggcctttgctgggttt
tacaagcttgataatcttgttgctatatttgatgttaaccgtcttggacaaagtgaccct
gcacctctgcagcatcatgttgaaatctaccagaaacgttgtgaagcctttggctggcat
gctatcattgttgatggtcacagcgtggaggaactttgcaaagcctttggtcaggccaaa
catcagccaacagctatcattgcgaagacctttaaaggcaaaggcatatcaggtgttgaa
gataaggaaagctggcatggaaaaccacttccaaaaaacatggctgaacaagtaattcag
gaaatagatgagaaaatccaaaacaagaaaaagctttctcctgccctccctgaagaagat
gctcctgtagtaaatatcagaaacataaagatgccatctccaccaagttacaaagtggga
gaaaagtgggctacccgcaaagcttatggccttgcacttgcaaaactgggccatgcaaat
gatcgagtgattgctttggatggagacacgaagaactctactttctcagagcttttcaag
aaagatcatcctagtcgctacattgaatgctacattgctgaacagaacatggtgagcgtt
gcagttggttgtgccactcgtgacagaactgttgctttcgccagcacctttgctaccttc
ttcacacgggcgtttgaccagatccgtatggctgcaatctctgagagtaacatcaatctc
tgtgggtcacactgcggtgtttctattggtgaggatgggccatctcagatgggactggag
gacctgtgcatgttccgagctattcccaatgccaccgtcttttaccccagcgatgctgta
gccactgaaaaagcagtggaaatagctgccaacactaagggcatttgtttcataagaact
agtcgtcctgaaaatcctgtcatttacaacaacaacgaggactttcatattggacaggca
aaggtgattctgaagagtaaggatgaccaagtgactgtgataggagcaggagtcactctg
catgaggctctggctgcagcagagcagctgagaaaagagaagatcttcatccgcgtgatt
gatcctttcactataaagcccctggataagaagacaatacttgaaaatgcaagagcaacc
aaaggcagaatcatcactgttgaggaccattaccatgaaggtggcattggagaagcagtg
tgtgctgcagtagtgggtgagcctggtgtcacagtcagtcgcttggctgtatctcatgta
ccacgaagcgggaagtcagctgagctgctgaagatgtttggtattgacaaagatgccatt
gtgcaagctgttaaggtggcagtgtccaaatcaagaaatgcagagtag

DBGET integrated database retrieval system