KEGG   Gallus gallus (chicken): 415996Help
Entry
415996            CDS       T01006                                 

Gene name
CACNA2D3
Definition
calcium channel, voltage-dependent, alpha 2/delta subunit 3
Orthology
K04860  
voltage-dependent calcium channel alpha-2/delta-3
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:gga04010]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:gga04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:gga04261]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
12
AA seq 942 aa AA seqDB search
MLENLNLLRASGFFFFIFWTAFNTALVDVVGSEQQIPLSVVKLWASAFGGEIKSIAAKYS
GSQLLQKKYKEYEKDVAIEEIDGLQLVKKLAKNMEEMFHKKSEAVRRLVEAAEDAYLKHE
FDADLQYEYFNAVLINERDEEGNYLELGKEFILVPNDHFNNLPVNISLSDVQVPTNMYNK
DPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFDC
RNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEEL
HYVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNMLNEFNHTGQGSIC
SQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQI
STLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDSTLPQAQKLADDQGLVLMTTVAM
PVFSKQNETRSKGILLGVVGTDVPVKELLKAIPKYKLGIHGYAFAITNNGYILTHPELRP
LYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVMT
NDYYYTDIKGTPFSLGVALSRGHGKYFFRGNVTVEEGLHDLEHPDVSLADEWSYCNTDLH
PEHRQMTQLEAIKRYLTGKEPLLQCDKELIQEVLFDAVVSAPIEAYWTSLALNKSENSDK
GVEVAFLGTRTGLSRINLFVGPEQLTNQDFLTAEDKENIFNADHFPLWYRRAAEQIPGSF
VYSIPFSTETANKSNVVTASTAIQLLDDRKSPVVAAVGIQMKLEFFQRKFWTASRQCASL
DGRCAISCDDEAINCYLIDNNGFILVSEDYGQTGNFFGEVEGAVMNKLLTMGSFKRSVRA
DLAVGVILPKMVSVQLTPMFRSLVMRLSTMCLSLPVHKTMAF
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgctagaaaatctgaatcttcttcgggcttctgggttttttttctttatcttctggaca
gcttttaacacagccttagtggatgtggttggatcggagcagcagatccccctgtctgtt
gtgaagctctgggcctcagcgtttggtggggagatcaaatctattgcagccaagtactcg
ggttcccagctcctgcagaagaaatacaaagaatatgagaaagacgttgcaatagaagaa
attgatggccttcagcttgtgaaaaagttagcgaagaatatggaagaaatgtttcataag
aagtccgaagctgtgcggcgtcttgttgaggctgcagaagatgcttatctgaaacatgag
tttgatgctgatttgcagtatgagtacttcaatgctgtgcttataaatgaaagagatgaa
gaagggaactatctggagctgggaaaggagttcattctagtgccgaacgaccacttcaat
aacttgcctgtaaatatcagtctgagtgatgtccaagtaccaactaatatgtataataaa
gatccagccattgtaaatggagtttattggtcagaatccttaaataaggtgtttgttgat
aactttgatcgtgacccttctctcatctggcagtactttggaagcgcaaaaggatttttc
agacagtatccaggaattaaatgggaacctgatgagaatggagtcattgcatttgactgc
agaaatagaaaatggtacatccaagcagcaacttctccaaaagatgtggtaattttagta
gatgtcagtggcagtatgaaaggacttcgcttgactattgctaagcagacagtttcatct
attttggatacccttggagatgatgacttcttcaatataattgcttataatgaagaactt
cactatgtagaaccgtgtctgaacggaacattggttcaagcagacagaaccaacaaagag
cattttagggaacaccttgacaagctttttgcaaaaggaattggaatgctggacattgct
ttaaatgaagctttcaacatgctcaatgaattcaatcacacaggacaaggaagtatttgc
agccaagccataatgttgattactgatggagctgtggacacatatgacacaatatttgca
aaatataattggccagacagaaaagttcgtattttcacctatctgattggaagagaagct
gcttttgctgacaacttgaaatggatggcctgtgctaacaaagggttttttactcagatc
tctaccttagctgatgttcaagagaatgtcatggaatatctccatgttcttagccgacca
aaagttattgaccaagagcatgacgtggtatggactgaagcatatattgacagcactctc
cctcaggctcaaaagcttgctgacgatcagggattggtgttgatgacaactgttgccatg
ccggtatttagtaagcaaaatgagactagatcaaaagggattctcctgggagtagttggc
acagacgtcccagttaaagaacttctaaaagctattccaaaatacaagttaggtattcat
ggatatgcttttgcaattacaaacaatggatatattttgactcatccagaacttaggcct
ttgtatgaagaaggaaagaaacgaagaaagcccaactacagtagtgtggatctttctgag
gttgagtgggaagacagagatgatgtgcttcgaaatgcaatggtgaatcgtaaaacagga
aaattctccatggaagtgaagaaaacagtggacaaagggaaacgggtattggtgatgaca
aatgactactattatacagacatcaagggtactccattcagtttaggtgtggctctctct
agaggacatggaaaatatttcttcagagggaatgtaactgtggaagaaggtttacatgat
ttagaacaccctgatgtatctttagcagatgaatggtcctactgcaacactgacttgcat
cctgaacaccgtcaaatgactcagttagaagcaattaaacgctacctcacaggaaaagag
ccattgctccaatgtgataaagaattgatccaggaagttctgtttgatgcagtggtgagt
gcaccaattgaagcttattggaccagtttagcactaaataaatcagaaaattctgacaag
ggagttgaagttgccttccttggaacacggaccggattatctcgtatcaacctgtttgtg
ggtccagaacagcttactaatcaagatttcctgacagctgaagacaaggaaaacattttt
aatgctgatcattttccactctggtatagaagagctgctgagcaaatacccgggagcttt
gtctattcaattccatttagtacagaaacagcaaacaaaagcaatgtagtgacagccagt
actgccattcaacttttggatgacagaaaatctccagtcgttgcagctgtaggtatccag
atgaaacttgaatttttccagcggaaattttggacagcgagcagacagtgtgcgtctctt
gatggcagatgtgcaataagttgtgatgatgaagcaatcaactgttacctaatagacaac
aatggatttatcctagtgtctgaagactatgggcagactggtaacttttttggggaggtt
gaaggggctgtgatgaacaaattgctaacaatgggctcctttaagagatctgtgcgcgcg
gatctggctgtgggcgtgattctgccaaagatggtcagtgttcaacttacacccatgttt
aggtctctagttatgcgtttgtctaccatgtgcctctctctgccagtccacaaaacaatg
gctttctag

DBGET integrated database retrieval system