KEGG   Gallus gallus (chicken): 415996Help
Entry
415996            CDS       T01006                                 

Gene name
CACNA2D3
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit alpha2delta 3
  KO
K04860  voltage-dependent calcium channel alpha-2/delta-3
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04260  Cardiac muscle contraction
gga04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    415996 (CACNA2D3)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    415996 (CACNA2D3)
   04261 Adrenergic signaling in cardiomyocytes
    415996 (CACNA2D3)
Ion channels [BR:gga04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   415996 (CACNA2D3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VGCC_alpha2 VWA_N dCache_1 VWA_3 VWA VWA_2 Cache_3-Cache_2 dCache_2 VWA_CoxE
Motif
Other DBs
NCBI-GeneID: 415996
NCBI-ProteinID: XP_015148891
CGNC: 4020
Ensembl: ENSGALG00000005400
Position
12
AA seq 1084 aa AA seqDB search
MLENLNLLRASGFFFFIFWTAFNTALVDVVGSEQQIPLSVVKLWASAFGGEIKSIAAKYS
GSQLLQKKYKEYEKDVAIEEIDGLQLVKKLAKNMEEMFHKKSEAVRRLVEAAEDAYLKHE
FDADLQYEYFNAVLINERDEEGNYLELGKEFILVPNDHFNNLPVNISLSDVQVPTNMYNK
DPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFDC
RNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEEL
HYVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNMLNEFNHTGQGSIC
SQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQI
STLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYIDSTLADDQGLVLMTTVAMPVFSKQ
NETRSKGILLGVVGTDVPVKELLKAIPKYKLGIHGYAFAITNNGYILTHPELRPLYEEGK
KRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVMTNDYYYT
DIKGTPFSLGVALSRGHGKYFFRGNVTVEEGLHDLEHPDVSLADEWSYCNTDLHPEHRQM
TQLEAIKRYLTGKEPLLQCDKELIQEVLFDAVVSAPIEAYWTSLALNKSENSDKGVEVAF
LGTRTGLSRINLFVGPEQLTNQDFLTAEDKENIFNADHFPLWYRRAAEQIPGSFVYSIPF
STETANKSNVVTASTAIQLLDDRKSPVVAAVGIQMKLEFFQRKFWTASRQCASLDGRCAI
SCDDEAINCYLIDNNGFILVSEDYGQTGNFFGEVEGAVMNKLLTMGSFKRITLYDYQAMC
RTNKESSDSAHSLLDPYNAFFAAVKWIMTELVLFLVEFNLCSWWHSDLTAKAQRLKQTLE
PCDTEYPAFVSERTIKETTGNIACDDCFKSFVIQQIPSSNLFMVVVDNECFCDSVPPITM
APIEIRYNESLKCERLKSQKIRRRPESCHGFHPEENARECGGVPGLSAKPPFVLLPLILT
IFSR
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atgctagaaaatctgaatcttcttcgggcttctgggttttttttctttatcttctggaca
gcttttaacacagccttagtggatgtggttggatcggagcagcagatccccctgtctgtt
gtgaagctctgggcctcagcgtttggtggggagatcaaatctattgcagccaagtactcg
ggttcccagctcctgcagaagaaatacaaagaatatgagaaagacgttgcaatagaagaa
attgatggccttcagcttgtgaaaaagttagcgaagaatatggaagaaatgtttcataag
aagtccgaagctgtgcggcgtcttgttgaggctgcagaagatgcttatctgaaacatgag
tttgatgctgatttgcagtatgagtacttcaatgctgtgcttataaatgaaagagatgaa
gaagggaactatctggagctgggaaaggagttcattctagtgccgaacgaccacttcaat
aacttgcctgtaaatatcagtctgagtgatgtccaagtaccaactaatatgtataataaa
gatccagccattgtaaatggagtttattggtcagaatccttaaataaggtgtttgttgat
aactttgatcgtgacccttctctcatctggcagtactttggaagcgcaaaaggatttttc
agacagtatccaggaattaaatgggaacctgatgagaatggagtcattgcatttgactgc
agaaatagaaaatggtacatccaagcagcaacttctccaaaagatgtggtaattttagta
gatgtcagtggcagtatgaaaggacttcgcttgactattgctaagcagacagtttcatct
attttggatacccttggagatgatgacttcttcaatataattgcttataatgaagaactt
cactatgtagaaccgtgtctgaacggaacattggttcaagcagacagaaccaacaaagag
cattttagggaacaccttgacaagctttttgcaaaaggaattggaatgctggacattgct
ttaaatgaagctttcaacatgctcaatgaattcaatcacacaggacaaggaagtatttgc
agccaagccataatgttgattactgatggagctgtggacacatatgacacaatatttgca
aaatataattggccagacagaaaagttcgtattttcacctatctgattggaagagaagct
gcttttgctgacaacttgaaatggatggcctgtgctaacaaagggttttttactcagatc
tctaccttagctgatgttcaagagaatgtcatggaatatctccatgttcttagccgacca
aaagttattgaccaagagcatgacgtggtatggactgaagcatatattgacagcactctt
gctgacgatcagggattggtgttgatgacaactgttgccatgccggtatttagtaagcaa
aatgagactagatcaaaagggattctcctgggagtagttggcacagacgtcccagttaaa
gaacttctaaaagctattccaaaatacaagttaggtattcatggatatgcttttgcaatt
acaaacaatggatatattttgactcatccagaacttaggcctttgtatgaagaaggaaag
aaacgaagaaagcccaactacagtagtgtggatctttctgaggttgagtgggaagacaga
gatgatgtgcttcgaaatgcaatggtgaatcgtaaaacaggaaaattctccatggaagtg
aagaaaacagtggacaaagggaaacgggtattggtgatgacaaatgactactattataca
gacatcaagggtactccattcagtttaggtgtggctctctctagaggacatggaaaatat
ttcttcagagggaatgtaactgtggaagaaggtttacatgatttagaacaccctgatgta
tctttagcagatgaatggtcctactgcaacactgacttgcatcctgaacaccgtcaaatg
actcagttagaagcaattaaacgctacctcacaggaaaagagccattgctccaatgtgat
aaagaattgatccaggaagttctgtttgatgcagtggtgagtgcaccaattgaagcttat
tggaccagtttagcactaaataaatcagaaaattctgacaagggagttgaagttgccttc
cttggaacacggaccggattatctcgtatcaacctgtttgtgggtccagaacagcttact
aatcaagatttcctgacagctgaagacaaggaaaacatttttaatgctgatcattttcca
ctctggtatagaagagctgctgagcaaatacccgggagctttgtctattcaattccattt
agtacagaaacagcaaacaaaagcaatgtagtgacagccagtactgccattcaacttttg
gatgacagaaaatctccagtcgttgcagctgtaggtatccagatgaaacttgaatttttc
cagcggaaattttggacagcgagcagacagtgtgcgtctcttgatggcagatgtgcaata
agttgtgatgatgaagcaatcaactgttacctaatagacaacaatggatttatcctagtg
tctgaagactatgggcagactggtaacttttttggggaggttgaaggggctgtgatgaac
aaattgctaacaatgggctcctttaagagaattacactttatgactaccaggccatgtgt
agaacaaacaaagagagtagcgacagtgcccatagcttactggacccttataatgccttc
tttgctgcagtaaaatggattatgacagagcttgtcttgttccttgtggagtttaatctg
tgcagttggtggcactctgatctaacagcaaaagcgcagaggttgaaacaaaccctagag
ccctgtgatactgaatatccagcttttgtttccgaacgcactataaaggagactacgggg
aatattgcttgcgatgactgtttcaagtcctttgtaatccagcaaatcccaagcagcaat
ctctttatggtggtagtagataatgaatgcttctgtgattctgtcccacccattaccatg
gcacctatagaaataagatataatgaatcccttaaatgtgaacgtttaaaatctcagaag
ataagaagacgcccagaatcttgccatggatttcaccctgaagaaaatgcaagagaatgt
ggtggtgtcccaggtcttagtgctaagcctccttttgttcttcttcctctgatattgaca
attttctcaaggtga

DBGET integrated database retrieval system