KEGG   Gallus gallus (chicken): 416496Help
Entry
416496            CDS       T01006                                 

Gene name
MAP2K3
Definition
mitogen-activated protein kinase kinase 3 (EC:2.7.1.-)
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Toll-like receptor signaling pathway
GnRH signaling pathway
Influenza A
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:gga04010]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:gga04620]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:gga04912]
Human Diseases; Infectious diseases; Influenza A [PATH:gga05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
14
AA seq 346 aa AA seqDB search
MDKKQDSKGSLEPHKPVKGKKKLRITCPPIKQPPVNTTPPRNLDSRTFITIGDKNFEVEA
DDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNTQEQKRLLMDLDISMRTVDCF
YTVTFYGALFREGDVWICMELMDTSLDKFYKKVLEKKKTIPEDILGKMAVSIVRALEHLH
SKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELN
QKGYNVKSDVWSLGITMIELAILRFPYESWGTPFQQLKQVVEEPSPQLPPERFSKEFVDF
TAQCLRKNPAERMNYLELMEHPFFTLHDTKETDMASFVTEILGDDS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaagcaagattccaagggatccctggagccgcacaaaccagtgaagggcaag
aagaagctgaggataacatgtcctcccatcaagcagccccctgtcaacaccacgccgcca
aggaacctggactccagaaccttcatcaccattggagacaaaaactttgaggtggaagct
gatgacctggtgactatttcagagctgggccggggggcctatggtgtggtggagaaagtg
aggcatgctcagagtggcaccatcatggccgtgaagaggattcgtgccacggtgaacact
caggagcagaagaggctgttgatggacctggatatctccatgaggacggttgactgcttc
tacacggtcactttctatggagccctattccgagagggcgatgtttggatctgcatggag
ctcatggacacttccctggataagttctacaagaaagtactggagaagaagaaaaccatc
ccggaggacatcttagggaaaatggctgtgtctattgtacgagctctggagcatctgcac
agtaaactgtctgtaatccacagagatgtgaagccttccaacgtgctcatcaacaaggag
ggacatgtgaaaatgtgtgactttgggatcagtggctacttggtggactcggtggcgaag
acaatggatgctggctgcaaaccatacatggctccagaaagaataaatcctgagctgaac
cagaagggctacaacgtgaagtcggatgtctggagtctggggatcacaatgatcgagttg
gccatcctccgcttcccctatgagtcctggggcaccccgttccagcagctcaagcaggtg
gtggaggagccctcaccccagctgccccccgagcgcttctccaaggagttcgtggacttc
acggcgcagtgtttaaggaagaaccccgctgagcgaatgaactatttagaacttatggag
caccccttcttcaccctacacgacaccaaagagactgacatggcctccttcgtgacagag
atcctcggggatgactcttaa

DBGET integrated database retrieval system