KEGG   Gallus gallus (chicken): 416501Help
Entry
416501            CDS       T01006                                 

Gene name
USP22
Definition
ubiquitin specific peptidase 22
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
14
AA seq 602 aa AA seqDB search
MGAQHPRPSARPAAPSAAPRAASAQRRPLWPPNPQPGPTFPGKASTRRGGGSAPAATRPP
PPPLSPQEITEAKSCICHMCGAHLNRLHSCLYCVFFGCFTKKHIHEHAKTKRHNLAIDLL
YGGIYCFMCQDYIYDKDMEQIAKEEQRKAWKLQAFTPTVVSHYQCTMTGIGEKYSTWEPT
KRELELLRHNPKRRKITTNCTIAVKQKCRMRSMQSGGAGSALNVIEFSSAAEHRTDTTTI
AVGASGQLNVGLRGLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHKCEMQSPSSCLVCE
MSTLFQEFYSGHRSPHIPYRLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDN
GKKANNPNHCNCIIDQIFTGGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSP
GSDGSVVNGESHVSGTTTLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPI
VACFHLKRFEHSAKLRRKITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKY
SLFAVVNHQGTLESGHYTSFIRQHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLE
YE
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgggagcacagcacccacggccctcagcgcggcctgctgcacccagcgctgccccccga
gccgcctcagctcagcgcaggccgctgtggccgcccaaccctcagccggggccgacgttc
ccgggcaaggcctctaccaggcggggaggtggctctgccccggcagcgacccggccgccg
ccgccgcccctctcccctcaggaaatcactgaggcaaagtcgtgcatttgtcatatgtgt
ggtgcccacctgaacagactccactcttgcctctactgtgtcttctttggctgttttaca
aagaaacatattcacgagcacgcaaagacaaagcgacacaatttagccatagaccttttg
tatgggggtatatactgctttatgtgtcaagattacatatacgacaaagacatggaacaa
attgccaaagaagaacaacgaaaagcttggaaattacaagccttcaccccaacagtggtt
tctcactaccagtgtacaatgacaggcattggagagaagtattcaacatgggagccaacc
aaacgagagttagaattgctacgacacaaccccaagcggagaaaaataaccacaaactgc
accatagctgttaaacaaaaatgccgaatgcgatccatgcagtcaggaggggcaggatct
gcactgaatgtaattgaattcagctctgctgctgagcataggacagacaccacaaccatt
gctgtgggtgcgtctggacaacttaatgtaggtctacgagggctaatcaatcttgggaac
acatgttttatgaactgtattgtccaggcacttacccacactccactgctgcgagatttc
ttcctctccgacaggcacaaatgtgaaatgcaaagccccagctcatgtctggtctgtgaa
atgtctacgctttttcaggagttttactctgggcaccgatctcctcacattccatatagg
ttattgcacctggtatggactcatgcacggcatttagcagggtacgagcaacaagatgca
cacgagttcctcattgctgcattagatgtgctacacagacactgcaaaggtgatgataat
gggaagaaggccaacaaccccaaccactgtaactgcatcatagaccaaatcttcacaggc
ggactacagtctgatgttacctgtcaagtctgccatggtgtttccacaacgatagaccca
ttttgggacatcagtttggatttgccaggctcctccaccccgttctggcctctgagtcca
gggagtgatggcagtgtcgtaaatggggaaagccatgtatcaggcaccaccactctcaca
gactgcttgcgaaggtttacaaggccagaacatctaggaagcagtgccaaaatcaaatgt
agtggttgccatagctaccaggaatctaccaaacaactcactatgaagaaattacccatt
gtggcctgttttcatctcaaacggtttgaacactcagccaaactgaggcgaaagatcact
acgtatgtctcatttccactggagctggacatgacaccattcatggcttccagtaaagag
agcagaatgaacgggcagtaccagcagccgacggatagtctaaacaatgataataagtat
tccttgtttgcagtagttaatcaccagggaactttggagagtgggcactataccagcttc
atccggcagcacaaggaccagtggttcaagtgtgatgatgccattatcaccaaggctagc
attaaggatgtactagacagtgaaggatatttgctgttctatcacaaacagttcctggag
tatgaatag

DBGET integrated database retrieval system