KEGG   Gallus gallus (chicken): 416501Help
Entry
416501            CDS       T01006                                 

Gene name
USP22
Definition
ubiquitin specific peptidase 22
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     416501 (USP22)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   416501 (USP22)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     416501 (USP22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
14
AA seq 602 aa AA seqDB search
MGAQHPRPSARPAAPSAAPRAASAQRRPLWPPNPQPGPTFPGKASTRRGGGSAPAATRPP
PPPLSPQEITEAKSCICHMCGAHLNRLHSCLYCVFFGCFTKKHIHEHAKTKRHNLAIDLL
YGGIYCFMCQDYIYDKDMEQIAKEEQRKAWKLQAFTPTVVSHYQCTMTGIGEKYSTWEPT
KRELELLRHNPKRRKITTNCTIAVKQKCRMRSMQSGGAGSALNVIEFSSAAEHRTDTTTI
AVGASGQLNVGLRGLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHKCEMQSPSSCLVCE
MSTLFQEFYSGHRSPHIPYRLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDN
GKKANNPNHCNCIIDQIFTGGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSP
GSDGSVVNGESHVSGTTTLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPI
VACFHLKRFEHSAKLRRKITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKY
SLFAVVNHQGTLESGHYTSFIRQHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLE
YE
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgggagcacagcacccacggccctcagcgcggcctgctgcacccagcgctgccccccga
gccgcctcagctcagcgcaggccgctgtggccgcccaaccctcagccggggccgacgttc
ccgggcaaggcctctaccaggcggggaggtggctctgccccggcagcgacccggccgccg
ccgccgcccctctcccctcaggaaatcactgaggcaaagtcgtgcatttgtcatatgtgt
ggtgcccacctgaacagactccactcttgcctctactgtgtcttctttggctgttttaca
aagaaacatattcacgagcacgcaaagacaaagcgacacaatttagccatagaccttttg
tatgggggtatatactgctttatgtgtcaagattacatatacgacaaagacatggaacaa
attgccaaagaagaacaacgaaaagcttggaaattacaagccttcaccccaacagtggtt
tctcactaccagtgtacaatgacaggcattggagagaagtattcaacatgggagccaacc
aaacgagagttagaattgctacgacacaaccccaagcggagaaaaataaccacaaactgc
accatagctgttaaacaaaaatgccgaatgcgatccatgcagtcaggaggggcaggatct
gcactgaatgtaattgaattcagctctgctgctgagcataggacagacaccacaaccatt
gctgtgggtgcgtctggacaacttaatgtaggtctacgagggctaatcaatcttgggaac
acatgttttatgaactgtattgtccaggcacttacccacactccactgctgcgagatttc
ttcctctccgacaggcacaaatgtgaaatgcaaagccccagctcatgtctggtctgtgaa
atgtctacgctttttcaggagttttactctgggcaccgatctcctcacattccatatagg
ttattgcacctggtatggactcatgcacggcatttagcagggtacgagcaacaagatgca
cacgagttcctcattgctgcattagatgtgctacacagacactgcaaaggtgatgataat
gggaagaaggccaacaaccccaaccactgtaactgcatcatagaccaaatcttcacaggc
ggactacagtctgatgttacctgtcaagtctgccatggtgtttccacaacgatagaccca
ttttgggacatcagtttggatttgccaggctcctccaccccgttctggcctctgagtcca
gggagtgatggcagtgtcgtaaatggggaaagccatgtatcaggcaccaccactctcaca
gactgcttgcgaaggtttacaaggccagaacatctaggaagcagtgccaaaatcaaatgt
agtggttgccatagctaccaggaatctaccaaacaactcactatgaagaaattacccatt
gtggcctgttttcatctcaaacggtttgaacactcagccaaactgaggcgaaagatcact
acgtatgtctcatttccactggagctggacatgacaccattcatggcttccagtaaagag
agcagaatgaacgggcagtaccagcagccgacggatagtctaaacaatgataataagtat
tccttgtttgcagtagttaatcaccagggaactttggagagtgggcactataccagcttc
atccggcagcacaaggaccagtggttcaagtgtgatgatgccattatcaccaaggctagc
attaaggatgtactagacagtgaaggatatttgctgttctatcacaaacagttcctggag
tatgaatag

DBGET integrated database retrieval system