KEGG   Gallus gallus (chicken): 416550Help
Entry
416550            CDS       T01006                                 

Gene name
SLC9A3R2
Definition
(RefSeq) SLC9A3 regulator 2
  KO
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
gga  Gallus gallus (chicken)
Brite
Transporters [BR:gga02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   416550 (SLC9A3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
14
AA seq 289 aa AA seqDB search
MARRRVVQRIKAVETETRLLVVDKETDEYLCSLRLTCTEEMAHSGILLGSSISPSKSVGS
DNGEVWKPQLELNAGSLQRHSHSFSSHSSRKDLNGQKELCPRLCHLKKGPSGYGFNLHSE
KSRPGQFIRSVDPDSPASRAGLRPQDRLVEVNGINVEGLRHSEVVSHIKARESEARLLVV
DPETDEYFKKLGVTPTEEHTKGVVPQPMTNGSAQMQLNGGSTSSSHSDLQSPGKESEDGD
SEKRDPFEESGLSLSPTAAEAKEKVRAKRVKKRAPQMDWNKKREIFSNF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggctcggaggcgggtggtgcagcgcatcaaagcggtggagacagagacccgcctgctg
gtggtggacaaggagacggatgagtacctgtgcagcctgcgcctgacatgcacggaggag
atggcacacagtgggatcctgctgggctccagcatctcgccctccaagtcagtgggcagc
gacaacggggaggtgtggaagccacagctggagctgaacgcaggcagcctgcagcggcac
tcacacagcttctcctcccacagcagcaggaaggatttaaacggacagaaagagctgtgt
ccacgcctctgccacctgaagaaaggccccagtggttatggcttcaacctgcacagtgag
aagtcccgtccggggcagttcatccgctcggttgaccccgactcaccagcatccagagcg
ggcctgaggccccaggaccgcctggtggaggtgaatgggataaatgtggaggggctgcgg
cactcagaagtggtgtcccatatcaaggccagagagagcgaagccaggttgttggtggtg
gaccctgagacggatgagtacttcaagaagctgggggtgacccccaccgaagagcatacc
aaaggtgtggtgcctcagcccatgacaaatggatctgcacagatgcagctgaatggagga
tccacatcttcatctcacagtgaccttcaaagtcctgggaaggaatccgaggatggagac
tcagagaagagggacccgtttgaggagagcgggctgagcctgagccccacggcagctgag
gccaaggagaaggtgcgggccaagcgggtgaagaagagggctccgcagatggactggaac
aagaaacgggagatcttcagcaatttctga

DBGET integrated database retrieval system