KEGG   Gallus gallus (chicken): 416550Help
Entry
416550            CDS       T01006                                 

Gene name
SLC9A3R2
Definition
solute carrier family 9, subfamily A (NHE3, cation proton antiporter 3), member 3 regulator 2
Orthology
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
gga  Gallus gallus (chicken)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
14
AA seq 354 aa AA seqDB search
MAKDQLKPRLCHMLKGENGYGFHLHGEKGKSGQFIRKVEPGSPAEAAGLRAGDRVVEVNG
LNVEQETHHQVVQRIKAVETETRLLVVDKETDEYLCSLRLTCTEEMAHSGILLGSSISPS
KSVGSDNGEVWKPQLELNAGSLQRHSHSFSSHSSRKDLNGQKELCPRLCHLKKGPSGYGF
NLHSEKSRPGQFIRSVDPDSPASRAGLRPQDRLVEVNGINVEGLRHSEVVSHIKARESEA
RLLVVDPETDEYFKKLGVTPTEEHTKGVVPQPMTNGSAQMQLNGGSTSSSHSDLQSPGKE
SEDGDSEKRDPFEESGLSLSPTAAEAKEKVRAKRVKKRAPQMDWNKKREIFSNF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaccagctgaaaccgcggctgtgccatatgctgaaaggggagaacggctac
ggcttccacctgcacggcgagaagggcaagagcgggcagttcatccgcaaagtggagccc
ggttcccccgccgaagcggcggggctgcgcgctggggatcgagtcgtggaggtgaatggg
ctcaacgtggagcaggaaacgcaccaccaggtggtgcagcgcatcaaagcggtggagaca
gagacccgcctgctggtggtggacaaggagacggatgagtacctgtgcagcctgcgcctg
acatgcacggaggagatggcacacagtgggatcctgctgggctccagcatctcgccctcc
aagtcagtgggcagcgacaacggggaggtgtggaagccacagctggagctgaacgcaggc
agcctgcagcggcactcacacagcttctcctcccacagcagcaggaaggatttaaacgga
cagaaagagctgtgtccacgcctctgccacctgaagaaaggccccagtggttatggcttc
aacctgcacagtgagaagtcccgtccggggcagttcatccgctcggttgaccccgactca
ccagcatccagagcgggcctgaggccccaggaccgcctggtggaggtgaatgggataaat
gtggaggggctgcggcactcagaagtggtgtcccatatcaaggccagagagagcgaagcc
aggttgttggtggtggaccctgagacggatgagtacttcaagaagctgggggtgaccccc
accgaagagcataccaaaggtgtggtgcctcagcccatgacaaatggatctgcacagatg
cagctgaatggaggatccacatcttcatctcacagtgaccttcaaagtcctgggaaggaa
tccgaggatggagactcagagaagagggacccgtttgaggagagcgggctgagcctgagc
cccacggcagctgaggccaaggagaaggtgcgggccaagcgggtgaagaagagggctccg
cagatggactggaacaagaaacgggagatcttcagcaatttctga

DBGET integrated database retrieval system