KEGG   Gallus gallus (chicken): 416580Help
Entry
416580            CDS       T01006                                 

Gene name
USP31
Definition
ubiquitin specific peptidase 31
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     416580 (USP31)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   416580 (USP31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
14
AA seq 1267 aa AA seqDB search
MSRVLKTLSTLSHYSSEPEPRGPQAPRLPPPRAAGGLGSCLPPGPPRRPEPPPPERGSEA
VPGVAGLRNHGNTCFMNAILQCLSNTELFAEFLALEQFRGPAEPGPPPPAPGEVTEQLAQ
LVRALWTLEYTPQHSRDFKNIVSKNAMQYRGNAQHDAQEFLLWLLDRVHEDLNNVVNYSG
MPPLKPPLEDDVLLEGPAFPISSTFVQELFQAQYRSSLTCPHCQKQSNTFDPFLCISLPI
PLPHTRPLYVTVVYQGKCSHCMRIGVAVPIAGTVARLREAVSSETKIPTEQIVLTEMYYD
GFHRSFCDTDDLDTIHESDCIFAFETPEIFRPEGILSQRGIHVNNNLNNLKYGTEHSRTV
SYSQGTVVSGKLEQSSTRQGANDKIVLLVCNRACTGQQSKRFGLPFVLHLEKTIAWDILQ
KEILEKMQYFLRPAACLQVCPFSLRVVSVVGITYLLPQEERPLCHPTVERALKSCGQGGT
AHVKLVVEWDKETKDFLFVNTEDEYIPDSESVRQQRELHHQPQTCTLSQCFQLYTKEEQL
APDDAWRCPHCKQLQQGSITLSLWTLPDVLIIHLKRFRQEGDRRMKLQNMVKFPLSGLDM
TPHVVKRSQSSWSLPSHWSPWRRPYGLGRDPEDYIYDLYAVCNHHGTMQAYCKNSVDGQW
YCFDDSDVQQLSENEVCKQTAYILFYQRRTAIPSWSANSSVAGSTSSSLCEHWVSRLPGS
KQPSIASAASSRRTSLASLSESVELTGERSEDDGGFSTRPFVRSVQRQSLSSRSSVTSPL
AVSENGVRPSWSLSAKLQMRSNSPSRFSGDSPVHTSASTLEKIGEAADDKVSTSCFGSLR
NLSSSYLEPCDGGRREQKAARRAPLAVMEGAFREEPVVRTSSSDLSDGVGKSSEQPDRSH
PVLDPFDNNNQIAFVDQSDSVDSSPVKEVKAPSGTGLAPEKAEGTPKKAHSSKGASEADR
SLRKGRTVLSTQETKASRSSPPPLKSSQKVSRSRSKADTSRAAGRHGSPAPTQGRKDHST
KSAEVAVPLAQQKQKSGSSPSSTAAKKAASGSLTKGSSAGKSRTSERSLSREGSKVSLGS
DKTSVTSSSRTSSPRISHSRSDSRAADSKHMRSSSMANLRSPNVGMRSGLKRDSKSEEKG
LSFFKSALRQKETRRSADLGKTTMLSKKAAGGSSKSASKNVLEDKSEKGGVPPASQTNAN
ITAKEKPVPKDAAPNKHSLLSSRKSKSSLLDPGARSPPSSGKQAADKPLKRLPSSMQVSV
RPSMEPQ
NT seq 3804 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgtgctgaagaccctctccacgctctcgcactacagcagcgagcccgagccc
cgcggcccgcaggccccgcgcctgccccctccgcgagccgccggcggcctgggcagctgc
ctcccgccgggcccgccgcgccgccccgagcccccgccgcccgagcgcggctccgaggcg
gtgcccggcgtggcggggctgcgcaaccacggcaacacctgcttcatgaacgccatcctg
cagtgcctcagcaacaccgagctgttcgccgagttcctggcgctggagcagttccgaggc
cccgcggagcccggcccgccgccccccgcgcccggcgaggtgacggagcagctggcgcag
ctggtgcgggcgctctggacgctggagtacaccccgcagcacagccgcgacttcaagaac
attgtgtccaagaatgccatgcagtaccgtgggaatgcccagcacgacgcgcaggagttc
ctgctctggcttctagacagagtccacgaggatctgaacaacgtggtgaattacagcggc
atgcctccgctcaagccaccgctggaggatgatgtgctgcttgagggaccagcctttcca
atcagtagtactttcgtgcaggaactctttcaagcccagtacaggtcctctctgacgtgc
cctcattgccagaagcagagcaacacctttgaccctttcctttgcatctctctgccgatt
cctttgcctcacacacggccactctatgtcactgtggtgtaccaggggaagtgctcccac
tgcatgcgcatcggggtggcagtacccatcgctgggacggtggccaggctgcgggaggcc
gtgtcctcagaaaccaagatacccaccgagcagattgtgctgacagagatgtactacgat
gggtttcatcgttccttctgtgacactgacgacctggacacaattcatgaaagtgactgc
atttttgcctttgagaccccggagatatttaggcctgagggtatccttagtcagagagga
atacatgtgaacaataacctgaataacttaaaatatggcactgaacactcacgaacagta
tcatactctcaaggaacagtggtgtctggaaaactggagcagtcctctaccagacaagga
gcaaacgacaagattgtcttgctggtgtgtaacagagcgtgcactggacagcagagcaaa
aggtttggcttgccctttgtgttgcatttggaaaaaacaattgcttgggatattctgcag
aaggaaatcttggagaagatgcagtatttcctgcggcctgcagcctgcttgcaggtctgc
ccgttcagcttgcgagtggtcagtgttgtgggcataacgtatttgctacctcaggaggag
cggcccctctgccatccaacagtggaaagggcgttgaagtcatgtggacaggggggaact
gctcatgtgaaattagtcgtagaatgggacaaagaaactaaagatttcttgtttgtgaac
acagaggatgagtatattccagactctgaaagcgtccgccagcagagagagcttcatcac
caacctcagacctgcactttatctcagtgtttccaactgtacaccaaagaggagcagctt
gccccagatgatgcgtggcgatgcccacactgcaagcagcttcagcagggtagcatcaca
ctgagcctctggaccttacctgatgttctcatcatacacctcaaaaggtttaggcaggaa
ggagaccgaaggatgaaacttcaaaacatggttaaatttcccctgagtggtttggatatg
acccctcacgttgttaagcgcagtcagagcagctggagtctgccgtcccactggtcaccc
tggaggcgaccttatggtctcgggagggatcctgaggactatatctatgacctgtatgca
gtctgcaatcatcatggcaccatgcaagcatattgcaaaaactcggttgacggccagtgg
tactgctttgatgacagtgatgttcagcagctttctgaaaacgaagtctgcaagcagaca
gcgtatattcttttctaccagagacgcacagcaatcccatcgtggtctgctaacagctct
gtggcaggctccacgagctcctcactgtgtgagcactgggtcagccgtcttcctggcagc
aagcagcccagcattgcttccgcagcatcatcgcggcgtacgtctctggcttcgctctca
gaatcggtggagctgactggagaaaggagtgaggatgatggaggtttttcaactcggccc
tttgtaagaagtgtccaacgtcagagcttgtcatccagatcttctgtcaccagcccactg
gccgtgagtgagaatggtgtcaggccctcgtggtcactctctgcaaagctgcagatgcgc
tccaactctccatcgcgcttctctggagattcccctgtgcacacctctgcttccaccctg
gagaagatcggggaggctgctgatgataaagtctccacctcttgctttggcagcttgagg
aatctctctagcagctacttggagccctgtgatggtggccggcgagagcaaaaggcggct
cgcagggcccccttggctgtcatggaaggggcattcagggaagagcctgtcgtaaggaca
tcgagctcagatctttcagatggggttggtaagagttcagagcagccagacaggagtcat
cctgttttggacccttttgataacaacaatcaaatcgcctttgttgatcagagtgattct
gtggatagctctccagtcaaggaggtgaaagcccccagtgggacaggactggctccagag
aaagcagagggaaccccaaagaaggctcacagctccaagggagcttctgaagcagacaga
agcttgaggaaaggaaggacggtcttatctacccaagagactaaagcgtctcgctcttct
cctcctcccctcaagagttcccagaaggtttcccggtctaggagtaaggctgacacctct
agggctgctgggcgacacgggtctccagcacccacccagggtaggaaagaccatagcacc
aagtctgctgaggtggctgtcccattggctcaacagaaacaaaagtcaggttcttctcca
tcctccacagctgccaagaaagccgcatcaggctcattgactaagggctcttctgctggg
aagagccggacttcagagcgaagcctcagcagggagggctctaaagtaagcctggggtca
gataaaacgagcgttaccagcagttcgagaacgagctccccacggatcagccactccagg
agcgacagcagggcagcagacagcaagcacatgcggagctcctctatggcaaacctgcgg
tctccaaatgttggtatgcgttctggtttgaagagagacagcaaatcggaagagaaggga
ttgtctttctttaaatcagccttaaggcagaaggagacccgtaggtcggctgacctggga
aagacaacgatgctctcgaaaaaggcagcgggtggcagctccaaatcggccagcaaaaac
gtgctggaggacaaatctgagaaaggtggagtcccaccggcctctcaaaccaatgccaac
attactgcaaaagaaaaacctgtcccaaaagatgccgcacccaacaaacactctctgcta
tccagccgcaagtccaagtcttccctgctagatcccggagcccggtctcctccttccagt
ggcaagcaggctgcagacaagccactgaaaaggttaccttccagcatgcaggtgtctgta
cggccttctatggaacctcagtga

DBGET integrated database retrieval system