KEGG   Gallus gallus (chicken): 416619Help
Entry
416619            CDS       T01006                                 

Gene name
EEF2K
Definition
eukaryotic elongation factor-2 kinase
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     416619 (EEF2K)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   416619 (EEF2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
14
AA seq 893 aa AA seqDB search
MCFTEGALSSCEVFGIGNPEHNAGVSHGATERRAARLAALRCSLHSFQPAFGTPFSHAHT
HKTQPKGSSSRRPSAQPSEPRGAAQSARWAGTEGRPAPLRSVPFHRRLRVLPGPLRCGVG
LCGSRFSPLPACALEQQLLPSVQELKCPPADMADEDLIFRMEGIDNARLTEVTSGNYLDA
DSDDEDNYYICPITDDPVSNKSASSKVDNYYSNLAKTEQYGSSSSPRNSFNYRNGTQHRS
KHGSVVDRSRETWKHAIEKAKHMPDPWAEFHLEDIETEHATRYRYNAVTGDWVEDEVLIK
MASQPFGRGAMRECFRTKKLSNFLHTQNWKAAYNYVAKRYIESVGREVYFEDVRLQMEAK
LWGEEYNRHKPPKQVDIVQTCIIEMKNRPGKPLFHLEHYIEGKYIKYNSNSGFVRDDNIR
LTPQAFSHFTFERSGHQLIIVDIQGVGDLYTDPQIHTESGTDFGDGNLGVRGMALFFHSH
SCNKICKSMGLAPFDLSSKEKDALDHSNKLLESAQTILRGTEEKCGSSRVRTISGSRPPL
LSRLSENSGDESMSDVAFDSLPCSPSSATPHSQKMDVLHWPVFNEVDNLVHKDYDQLDNQ
RDFENGGDSGYPSEKRSELEDLDHREKGHSNNNRRHESDEDSLGSSARISVEKWNLYNSS
RVHIHRPSCVAQEIQRLNALELEKKIGKSILGKVHLAMVRYHEAGRFCEKDKEWDRESAL
FHLEHAADCGELEAIVGLGLMCSQLPHHILSEVTLEDTKENRKRGFDYLLRAAEAGDRPS
MILVARAYDTGVNLGSDRVQDWREALYWYNAALNMTDYDEGGEYDGTQDEPRYLLLAREA
EMLMTGGFHLDKDPQRSGDLYTEAAEAAMEAMKGRLANQYYQKAEEAWAMMEE
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttcactgagggagcgctgagcagctgtgaagtgtttggcattggaaacccggag
cacaacgccggtgtttctcacggggcaaccgagcgccgtgcagcgcgcctggccgccctc
cgctgcagcctccacagcttccaacctgcgtttgggactcctttttctcacgcacacaca
cacaaaacgcagcccaagggaagctcctcccgccggcccagcgcgcagccctcagagccc
cgcggggcggctcagtcagcgcggtgggcgggaaccgagggccgccctgccccgctccgt
tccgttccgttccacaggcggctgcgagtgctgccgggaccgctccgctgcggcgtcgga
ctctgcggctcccgcttctcccctctgcctgcatgtgcgttggaacagcagctgcttccc
tcagtgcaggagttaaagtgccctcccgcagacatggccgacgaggaccttatcttccgc
atggaaggcattgataatgctagactgaccgaagtgacctctggaaattatctggatgca
gacagtgatgatgaggacaactattatatctgcccaataactgatgatccagtttctaac
aagtctgccagtagtaaagttgacaattattatagcaacttagccaaaaccgagcagtac
ggttccagctcttctcctagaaactcctttaactacaggaatggcacacagcatcgctct
aagcacggctctgtggttgaccgtagtcgggaaacctggaaacatgctattgaaaaagct
aagcacatgcctgatccttgggcagaatttcatcttgaggacatcgagacagaacatgcc
actcgctacaggtacaatgcagttactggggactgggttgaagatgaagttctcatcaag
atggcttcacaaccctttggccgtggagcaatgcgagaatgtttcagaacgaagaagcta
tccaacttcttacacactcagaactggaaagctgcctataactatgttgccaagcggtac
atagagagtgtaggcagggaggtgtattttgaggatgtccgacttcagatggaagcaaag
ctctggggggaagagtacaatcggcacaaaccacccaaacaggtggatatagtacagacc
tgtataatcgaaatgaagaacagacccggaaagcctctctttcatctggaacattacatt
gagggcaaatacatcaaatacaactcaaattctggatttgtgcgagatgacaacattcgt
cttacaccgcaagccttcagtcacttcacatttgagcgctcaggacatcaactcattatt
gttgatatccagggagttggagatctttacacggaccctcaaatccatacagagagcggt
acagattttggagatggcaatctaggtgttcgaggtatggccttattctttcactctcat
tcttgtaacaagatttgcaaaagcatgggccttgcaccatttgacctttcatccaaagaa
aaagatgccttggatcatagtaacaaattgcttgaatcggctcagacaattctgcgtggc
acagaggagaagtgtggcagcagccgggtgaggaccatctctggtagtcggcctcccctg
ctctcccgcctgtctgaaaactctggagatgaaagcatgagtgatgtggcgtttgactcc
ctgccctgctctccttcttctgcaaccccccacagccaaaagatggacgtgcttcattgg
cctgtgttcaatgaagtagataatttggttcacaaggactatgatcagcttgataaccaa
agggattttgaaaatggtggagacagtggatatcccagtgagaagagaagtgagctagaa
gatctggatcatagagagaagggccattcaaacaacaaccgaagacatgaatctgatgaa
gacagtttgggaagctctgcaaggataagtgtggagaaatggaatctctacaattcttcc
agagtccacatccacagaccatcctgtgttgctcaagaaattcagaggctcaatgcacta
gaacttgaaaagaaaattgggaagtcaatccttgggaaggttcatctggccatggttcgt
taccatgaggcggggcgtttctgtgagaaggacaaggagtgggatcgtgagtcagctctg
ttccacctggagcatgctgcagactgcggggagctggaagccattgttgggttaggactc
atgtgctcacagctgccacatcacattctttctgaggtcactttagaggacacaaaggag
aaccgaaaaagaggatttgattacttgctgagagcagcagaagctggagaccggccttcc
atgattctggtagcaagagcatacgatacaggtgtcaatctaggttcagacagagtacag
gattggagggaggctctgtactggtacaacgctgccctgaacatgactgactatgatgag
ggaggtgaatatgatggcactcaggatgagccccggtatctgctcctggccagggaagca
gagatgctaatgacaggagggttccatctggacaaggacccacagagatcgggtgatctc
tacacagaagcagcggaagcagcaatggaagcaatgaagggcagactggcaaatcagtac
taccagaaagcagaagaggcttgggcgatgatggaagaatga

DBGET integrated database retrieval system