KEGG   Gallus gallus (chicken): 416667Help
Entry
416667            CDS       T01006                                 

Gene name
CREBBP
Definition
CREB binding protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
gga  Gallus gallus (chicken)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    416667 (CREBBP)
   04330 Notch signaling pathway
    416667 (CREBBP)
   04350 TGF-beta signaling pathway
    416667 (CREBBP)
   04630 Jak-STAT signaling pathway
    416667 (CREBBP)
   04068 FoxO signaling pathway
    416667 (CREBBP)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    416667 (CREBBP)
  Cell communication
   04520 Adherens junction
    416667 (CREBBP)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    416667 (CREBBP)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    416667 (CREBBP)
   05168 Herpes simplex infection
    416667 (CREBBP)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     416667 (CREBBP)
Transcription factors [BR:gga03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    416667 (CREBBP)
Mitochondrial biogenesis [BR:gga03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    416667 (CREBBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
14
AA seq 2355 aa AA seqDB search
MGKSPLNQGDSSASGLAKQVASTSGPTTPASQTLNSQAQKQVGMVTSSPATSQTGPGICM
NTNFSQTHQSLLNSNSGHSLMNQPQQGQGQVMNGSLGAAGRGRGAGMQYSAPAMQGNAGS
VLAETLTQVSPQMAGHTGLNTAQTGAITKMGMAGNTSPFGQPFSQTGGQQMGATGVNPQL
PNKPGMANSLPAFPADIKSTPVTSVPNMSQMQTQVQQVGIVPTQAMATGPTADPEKRKLI
QQQLVLLLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQ
IISHWKNCTRHDCPVCLPLKNASDKRNQQPLLGSPAGGMQNSIGSVGTGQQNNPSLSNPN
PIDPSSMQRAYAALGLPYGNQPQTQLQPQVQGQQPAQPQAHQQMRTINALGANQMNLPTG
GITTDQQASLISETALPTSLGTNNPLMNDGTNSGNVGNLSSMPTAAPPSSTGVRKAWHEH
VTQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANSRDEYYHLLA
EKIYKIQKELEEKRRSRLHKQGILGTQPALQTPGPQPPGIPQVAAAMGQAQPVRPPNGPM
SMTTVPISRMQVSQGMNQFNPMSIGNVQMPQAPMGPRAASPMNHPVQMNNMGAVPAMAMS
PSRMPQPQNMMGAHSNNMMGQAPTQNQFLPQNQFPASTGAMNVNNVGMGQSAAQAGVAQQ
GQVPSAALPNSMNMLGPQSGQLCPPVTQPPLHQTTPPVSTAAGMPPIQHQTPTGMTPPQP
AAPTQPSTPVSSSGQTPTPTPGSVPNATQTQSTPTGQTAAQAQVTPQPQTPVQPQSVPTP
QPSQQQPTSVQAQPPGTPLSQAAASIDNRVPTPASVASADTNSQQLGPDAPMLESKSEVK
TEETEPETSETQVEAKTEVEEDLQGSSQTKEETDGTELKQEPMEIEEKKPEIKVDAKEEE
ESGTNGTTSQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIP
DYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCTKLAE
VFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNSSPKYGLLADR
YHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQI
CVLHYDIIWPSGFVCDNCLKKTGRTRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPE
AGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMH
VQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWA
CPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTS
AKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKT
NKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPD
PLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHH
VETRWHCTVCEDYDLCINCYNTKSHDHKMVKWGLGLDDESNSQGEQQSKSPQESRRLSIQ
RCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHC
QENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSATPGTP
TQQPSTPQTPQPPPQPQPSPVSMSPAGFPNVSRTQPPTTVSTGKPANPVAAPPPPAQPPP
AAVEAARQIEREAAQQQQQQLYRVNNINNGLPPGRPGLVNPTVGSVSQMQQVGMNVPRPS
PVSGPVMSNMQPGQWQSPPMPQQQAMQPGMARPVMPMATAQAVAGPRMPGVQQPPRSIPP
NALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQAGIQPQ
PGMQQPQTGMQQPGMHAQPGLQNMNAMQAGVQRPSVPPQQQGIGAMNPQGQAINIMNPGH
NTSMASMNHPQYREILRRQLLQQQQQQQQQQGGAGMAAGMAGHSQFQQPQGPGGYPQAMQ
QQRMQQHISIQGGSMGQMAQMGQLNQMGQPGLGADGTPNIQQALQQRILQQQQMKQQIGS
PGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSSQVRSPAPVQSPRPQSQPPHSSPSPRI
QPQPSPHHVSPQTGSPHPGLAVTMASSMDQGHLGNPEQSAMLPQLNTPNRSALSNELSLV
GDTTGDTLEKFVEGL
NT seq 7068 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagagcccgttaaaccagggagactcttctgcttcaggcctggcaaagcaagtt
gccagcacctctggacctaccacacctgcatcgcaaacactgaactctcaagcacaaaaa
caagtggggatggtgacgagcagccctgcaacatcacagactggacctggaatatgtatg
aatactaatttcagtcagacacaccagagccttctcaacagtaattctggtcacagttta
atgaatcagcctcagcaaggacaagggcaggtaatgaatggatctcttggggcagctgga
agaggaaggggagcaggaatgcaatattctgcccctgccatgcaggggaatgcaggcagt
gtgctggcagagactttaacccaagtatctccacagatggctggtcacaccgggctgaac
acagcacagacaggagcaattacaaaaatgggaatggcaggtaacaccagcccctttggg
caacctttcagtcaaactggagggcagcagatgggagcgacgggcgtgaatcctcagtta
ccaaacaagccgggcatggccaacagtttgcctgccttccccgctgacatcaagagtact
ccagtcaccagtgtgcccaacatgtcccagatgcaaactcaagtgcagcaagtggggatt
gtaccaacgcaggccatggcaactggaccaacagcagacccggagaagcgcaaactgatc
cagcagcagttggttttgctgcttcatgcccacaaatgtcagaggcgtgagcaggcgaac
ggagaggtgcgagcctgtgctctgccacactgccgaaccatgaagaatgtcctcaaccac
atgacgcactgccaggctgggaaggcctgtcaagttgctcattgtgcatcttcgagacaa
atcatctcccactggaagaattgtactcggcacgactgtcccgtgtgccttcccttgaaa
aatgccagtgacaagagaaaccaacagcccctcttagggtctccagctggtggaatgcag
aattccattggttcagttggaacaggccagcagaataatccatcgctaagtaatcctaat
ccgattgaccccagctccatgcaacgagcctatgctgctcttggactcccatatggcaac
cagcctcagacacagttgcagccccaggtacaaggccaacagccagcacagcctcaggct
caccagcaaatgaggaccattaatgcattgggagccaaccagatgaaccttcccacagga
ggaataacaacagaccagcaagctagtctaatttctgaaactgctcttccaacatccctt
gggacaaataaccccctaatgaatgatggcacaaattctggcaatgttggaaacctcagc
tcaatgccaacggctgcacctccttctagtaccggggtaaggaaagcatggcatgaacat
gtcactcaggacctgcgcaatcatttagtgcataaacttgtccaagccatcttccccact
ccggatccggcagcactgaaggatcgccgcatggagaacttggtggcttatgcaaggaaa
gttgaaggagatatgtatgaatctgccaacagcagggatgaatactatcacttattagca
gaaaaaatctataagatacaaaaggagctagaagagaagcggaggtctcgtctgcataaa
caagggatcttgggaacacagccagccttacagacgccgggacctcagccccctggcatc
ccacaggtggctgctgccatgggccaggcacagcctgtgaggcctcccaatgggcctatg
tccatgacaactgtgcctataagtcgtatgcaggtttctcaaggaatgaatcagtttaac
cccatgtccatagggaatgtacagatgccacaagcacccatgggaccccgtgcagcttct
ccaatgaaccatcctgtacagatgaacaacatgggcgctgttcctgcgatggcaatgtct
ccttcccgaatgcctcagccacagaacatgatgggagcccattccaacaacatgatgggt
caggctcctacccagaaccaattcctgccccagaatcagtttccagcttccacaggggct
atgaatgtgaacaacgttggcatgggccagtcagcagcccaggcaggggtggcacagcag
gggcaggttcccagtgctgctcttcccaactccatgaacatgctaggaccacagagtggt
cagctatgcccaccagtgacccagccgcctctgcatcagactacacctcctgtgtccact
gctgctgggatgccgcctattcagcaccaaacaccaactggaatgactcctcctcagcca
gcagcacccactcagccatccacaccagtctcatcttcaggacaaacccctacaccgacc
ccgggttctgttcccaacgcgacccagacacaaagcacgcctacgggacagactgcagca
caggctcaagtcacaccgcagcctcagaccccagttcagccccagtctgtgccaacccca
cagccttcccagcaacagccaacatctgtgcaggcacagccacctggcactccactatcc
caggcagcagctagtattgataacagggtccccacccctgcctcagttgctagtgctgat
acgaattcccagcaactaggaccagatgcaccaatgctagaaagcaaatcagaagttaaa
actgaagaaactgagccagagactagtgagacacaagtggaagctaagactgaggtggag
gaggatttacaaggatcttcacaaacaaaggaggaaacagatggaactgagctgaaacaa
gagccaatggaaatagaagaaaagaagcctgaaataaaagtagatgctaaggaggaagag
gaaagtggcactaatggaaccacttcacaatccacatcgccatctcagccccgcaaaaaa
attttcaaacccgaggagctgcgccaggcactcatgcccacgctggaagccctgtaccgg
caggacccggagtctctgcctttcaggcagcccgtggatccccagctcttagggattccg
gactactttgacattgtgaagaatcctatggacctctcaaccattaaacgtaaactagac
acggggcagtaccaggagccctggcagtacgtggacgacgtgtggctgatgttcaacaac
gcctggctttacaatcgcaagacttccagggtctataagttttgcactaaactggcagag
gtgtttgaacaagaaattgatcccgttatgcaatcccttggctactgctgtgggcgcaag
tatgagttttctccacagaccttgtgctgctatggcaagcagctgtgtactatccctcgt
gatgctgcctattacagctaccagaatagttcacccaaatatggccttcttgctgacagg
tatcacttctgtgagaagtgtttcactgaaatccagggggagaatgtcaccctgggtgat
gacccttcccagcctcaaacaaccatctctaaagatcagtttgagaagaagaagaatgac
acgctagatcctgagccgtttgttgactgcaaggagtgtggtcggaagatgcaccagatt
tgtgtattacattatgatattatttggccttcagggtttgtctgtgataattgtctgaag
aaaactggtagaacacggaaggaaaacaagttcagtgctaaaaggctgcagaccacccgc
ttgggaaaccatttggaggacagagtgaacaagtttctgaggagacagaatcatcccgag
gccggagaggtctttgtcagagtggtagcaagttcagataagacagtagaagttaaacca
gggatgaaatccagatttgtggattctggggagatgtcagaatccttcccttaccgtacc
aaagctctgtttgcttttgaggagatagatggagtagatgtctgcttctttggcatgcat
gtgcaggagtatggctcggactgcccccctccaaacacaagacgtgtgtacatatcgtat
ctagatagtattcatttcttccgcccccgttgtctccgaactgcagtttatcatgaaatc
ctcattggatatttggagtacgtgaagaaacttgggtatgtgacaggacacatctgggcc
tgtcccccaagtgaaggagatgactatatttttcattgccatccacctgatcagaaaatt
cccaagcccaaacgcttacaggaatggtataagaagatgctggacaaggcatttgctgag
agaatcattcacgactacaaggacatcttcaaacaagcaactgaagacaggctgacgagt
gccaaggagctgccttactttgaaggtgatttctggcccaacgtgctggaagaaagcatt
aaagagctggagcaggaggaggaggaaaggaagaaggaagaaagcactgcagccagtgaa
acaacagagggaagccagggtgacagcaagaacgccaagaaaaagaacaacaaaaaaacc
aacaagaataagagtagcatcagcagagctaacaagaagaaacccagcatgccaaacgtg
tccaatgatctgtctcagaagctgtatgccaccatggagaagcataaagaggtctttttt
gtgattcatttacacgctgggcctgtaattaacactctgcctcccattgtggaccccgac
ccactgctgagctgcgatctgatggatgggcgggatgccttcctcaccttagccagagat
aagcactgggagttctcctcgctgcgccgatccaagtggtccacgctctgcatgctggta
gagctccacacccaagggcaggaccgctttgtttatacgtgcaatgagtgcaagcatcat
gtggagacgaggtggcattgcactgtgtgcgaggactacgacctctgcattaactgctac
aacactaagagccatgaccacaagatggttaagtggggcctgggtctggacgatgagagc
aacagccaaggggagcagcagtcgaagagcccccaggagtcgcgacggctgagcatccag
cgctgcattcagtccctcgtccacgcctgtcagtgccgcaacgcaaactgctcgttgcca
tcctgccagaagatgaaacgggttgtgcagcacaccaagggctgcaagcgcaagaccaac
ggcggctgcccggtgtgcaaacagctcatagctctttgctgctaccatgccaaacactgc
caagagaacaaatgccccgtgccattctgtctcaacatcaaacacaagctccggcagcag
cagatccagcaccgcctgcagcaggctcagctcatgcgcagaaggatggctaccatgaac
acccgaaacgtgcctcagcaaagtttgccttctcctacctcagcaacgcctggtaccccc
acgcagcagccaagcacgccgcaaacaccgcagcctcctccccagccccagccttcccct
gtaagtatgtcaccggccggctttcccaatgtgtccagaactcagccccccactactgtt
tcgacaggaaaacccgccaacccggttgcagcccctccacctccggctcagccgccgccg
gccgcggtggaagcggctcggcagatcgagagagaggctgcccagcagcagcagcagcag
ctctacagggtcaacaacatcaacaatggtttgcctcctggtcgcccggggctcgtaaac
ccgacggtgggttcggtgagccagatgcagcaagtcggcatgaatgtaccccggcccagc
cccgtcagcggcccggtgatgtccaacatgcagcctgggcagtggcagtcgcctcccatg
ccgcagcagcaagcaatgcagccgggaatggcgaggccggtcatgccgatggcgacggcg
caagcggtggccgggccgaggatgccgggcgtgcagcagccgccgcggagcatccctcca
aatgcacttcaggacttgctgaggaccttgaaatcaccgagttctccgcagcagcagcag
caggttcttaatatccttaagtccaaccctcagcttatggcagcttttataaagcaaaga
acggccaaatacgtggctaaccagcccgggatgcagccgcaagcgggtatacagccccag
cctggcatgcagcagccgcagaccggcatgcaacagccgggcatgcacgctcagccggga
ttgcagaacatgaacgcgatgcaggcgggagtgcagagaccgagcgttcctccccagcag
caagggataggagctatgaatccgcagggacaagcgatcaacatcatgaaccccggccac
aacactagcatggcaagcatgaatcatccgcagtaccgagagatcctgagaaggcaactg
ctgcagcagcagcaacagcagcagcagcagcaaggaggggctggcatggcggcagggatg
gccggccacagccagttccagcagccccaaggaccgggaggttacccgcaagccatgcag
cagcagcggatgcagcagcatatatcgatacagggggggtccatgggacagatggctcag
atgggacagctgaaccagatgggccagcccggcctgggggcggacggcactcccaacatc
cagcaggcgctgcagcagaggatcctgcagcagcagcagatgaagcagcagataggctct
ccgggccagcccaaccccatgagcccacagcagcacatgctctcaggacaaccgcaggcg
tctcatctccccggccagcagatcgccacctccctcagcagccaggtgcggtccccggcg
cccgttcagtctccccgcccccagtcccagccgccacattccagcccgtccccgcggatt
cagccccagccgtcgccgcaccacgtctcgccccagactggttccccccacccaggactc
gcagtcactatggctagctccatggatcagggacacttgggcaacccggaacagagtgca
atgcttccacaactaaacacccccaacaggagtgcgttgtcaaacgaattgtctctggtc
ggtgataccaccggggacacgttagaaaaatttgtggagggtttgtag

DBGET integrated database retrieval system