KEGG   Gallus gallus (chicken): 416730Help
Entry
416730            CDS       T01006                                 

Gene name
PLCB4
Definition
phospholipase C, beta 4 (EC:3.1.4.11)
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
gga  Gallus gallus (chicken)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
GnRH signaling pathway
Melanogenesis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    416730 (PLCB4)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    416730 (PLCB4)
   04020 Calcium signaling pathway
    416730 (PLCB4)
   04070 Phosphatidylinositol signaling system
    416730 (PLCB4)
 Cellular Processes
  Cell communication
   04540 Gap junction
    416730 (PLCB4)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    416730 (PLCB4)
   04916 Melanogenesis
    416730 (PLCB4)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    416730 (PLCB4)
   04270 Vascular smooth muscle contraction
    416730 (PLCB4)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     416730 (PLCB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
3
AA seq 1194 aa AA seqDB search
MAKPYEFNWQKPVPSFMQDGAVFDRYEEESFVFESSCLFQVDEFGFFLSWKSEGKEGQVL
ECSLINSVRFGAVPKDPKILTALEAVGKSENELEGRIVCVCSGIDLVNISFTFMVAENTE
VAKQWVEGLGSIIHNFRANNVSPMTCLKKHWMKLAFLTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPTAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDTKRAMQIIETYEPDEDLKSKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQPLETHPLDPGKALPSPNDLKRKILIKNKRLKPEVEKKQLDALKKM
MEAGETAAPVNILEDDNEEEIESADQEEEAHPEYKFGSDLTVDDYSQKEAVAISVKKGLV
TVEDEQAWMASYKYVGATTNIHPYLSTMVNYAQPVKFQGFDVAEERNIHHNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNK
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTVFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPNDTSKNDRKGKANNAKANVTPQSSSELRPSTTAG
FGSGTDAKKGIDLIPQVKIEDLKQMKAYIKHLKKQQKELNALKKKHAKEHSAMQKLHCTQ
IDKIVAQYDKEKVSYEKMLEKAIKKKGGSNCVELKKETEIKIQALTSDHKSKVKEIVAQH
TKEWSEMINTHSAEEQEIRDLHLNQQCELLKKLLINAHEQQTQQLKFSHDRESKEMRANQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEVLEKQNEQLLKSCHAVSQTQGKGDAADGEAGSRDGSQASNSGLKPQHAN
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaccttatgaatttaactggcagaagccggttccctcttttatgcaagatgga
gctgtgtttgatagatatgaagaggaatcttttgtctttgaaagcagttgtctctttcaa
gtggatgaatttggcttttttctgagctggaaaagtgaaggaaaggaaggacaggtgtta
gagtgttccctgatcaacagtgttcgttttggagctgttccaaaggatcccaaaatacta
actgcacttgaggctgttggaaaatcagaaaatgagttggaaggacggatagtgtgtgtt
tgcagtggtatagatctggtgaacatcagcttcactttcatggtagcagaaaacacagaa
gtagccaagcaatgggtagaaggactgggatccatcatacataactttagagctaacaat
gtcagtccaatgacatgtctcaagaaacactggatgaagctggcctttctaacaaataca
aatgggaaaattccagttcggagcattaccagaacctttgcatcaggtaaaacagaaaaa
gtgatctttcaagcactcaaggagttaggtcttcccagtggaaagaatgatgaaattgag
cccacggcatttacttacgagaaattctatgagctcacccaaaagatatgtccccgaact
gacatagaggacctctttaagaagatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcggctcaatgaaattttattt
cccttttatgacacaaaaagagcaatgcagataattgagacatatgagccagatgaagac
ttgaagagtaaaggtctcatatcaagtgatggattttgcagatacttgatgtcagatgag
aatgccccagttttcctagaccgtttggaattataccaagaaatggaccacccgttggct
cactattttatcagttcttctcacaacacgtatttaacaggcaggcagtttggtggcaaa
tcttcggtggagatgtacagacaagtgctcttggctggatgcaggtgtgttgagctggac
tgttgggatggaaaaggtgaagaccaagaaccaataataacacatggaaaagcaatgtgc
acagatattcttttcaaggatgtaattcaagccattaaggaaacagcttttgttacatca
gagtatcccgtcattctttcatttgaaaatcattgcagcaaatatcagcagtacaagatg
tcaaaatactgtgaagatctttttggagatctcctgttgaagcagcctctagaaacacat
ccacttgatccaggtaaagccttgccttctcctaatgacctcaaaagaaagattctcata
aagaataaaaggttgaaacctgaagtagaaaaaaaacagctcgatgctctgaaaaagatg
atggaggctggtgaaaccgctgctcctgtgaatatcttagaggatgataatgaagaagaa
atagaaagtgctgaccaggaagaagaagctcatccagaatataaatttgggagtgacctt
actgtagatgattacagtcaaaaagaagctgttgctatcagcgtcaaaaagggcttagta
actgttgaagatgaacaggcatggatggcatcgtataaatatgtaggtgccacaaccaat
atacatccatatttatcaacaatggtcaactatgctcagcctgtaaaatttcaaggtttc
gacgtagcagaagaacgtaatattcatcataacatgtcctctttcaatgaatcagttgga
ctagggtatttgaagactcatgccattgagtttgtgaattataataaacgacaaatgagt
cggatatacccaaagggaggccgagtggattccagtaattacatgcctcaaattttctgg
aacgctggctgccagatggtctcactgaactatcagaccccagatttagcaatgcagttg
aatcaaggaaaatttgaatataatggatcatgtggctatctacttaaaccagatttcatg
cggcgcccggatagaacatttgaccctttctctgaaactcctgtagatggtgtaattgct
gcaacatgttctgtacaggtaatatctggtcagtttttatcagataaaaagattggtacg
tatgtagaagtggatatgtatggtttacccacggacacaatacgtaaagaatttagaacg
cgcatggtgatgaacaacggtctgaaccctgtttacaatgaagaatcatttgtatttcga
aaggttattctccctgatcttgctgtcctgagaatagcagtatatgatgacaataataag
ttgatcggtcagaggatcctgcctctagatggtctacaagcaggttacagacacatttca
cttcgaaatgagggcaacaaaccactctctcttccaacggttttctgcaacattgtgctc
aaaacatatgtgcctgatggttttggagatattgtagatgctttgtcagatccaaagaaa
tttttgtctattacagaaaaaagagcagaccaaatgagagctatgggtattgaaactagt
gatatagctgatgtaccaaatgacacttcaaaaaatgatagaaaaggaaaagctaataac
gccaaagcaaacgtgactcctcagagtagctctgagcttcgaccaagtaccacggcaggc
tttgggtctgggaccgatgctaagaaaggtatagacctaattcctcaagtgaagatagaa
gatttaaagcaaatgaaggcttacataaaacatttaaagaaacagcagaaagagctgaac
gccttaaagaagaagcatgcaaaggagcacagcgctatgcagaagttgcactgcacacaa
attgacaaaatagtggcacaatatgataaagaaaaggtatcatacgagaaaatgttagag
aaggcaatcaagaagaagggaggaagtaattgtgttgaattgaagaaagaaactgaaatt
aaaattcaggcactaacgtcagatcacaaatctaaggtcaaagagattgtggcacagcac
actaaagagtggtctgagatgatcaatacgcacagtgcagaagagcaagaaatccgtgat
ttacacttgaaccaacagtgtgaactactgaagaaactgctgattaatgctcatgaacaa
cagacccagcagctaaaattttcacatgacagggaaagcaaggagatgcgtgcaaaccag
gctaaaatatctatggagaacagcaaagccataagccaagataaatctatcaaaaacaaa
gcagaaagagagaggcgagtcagagaattgaacagcagcaacacaaaaaagttcctggaa
gagagaaaaaggcttgcaatgaaacagtcaaaggaaatggatcagttgaaaaaagttcag
cttgagcatttagaagtcttggaaaagcagaatgagcagcttttgaaatcctgtcatgca
gtgtctcaaacacaaggcaaaggagatgcagcagatggtgaagctggaagcagagatgga
tcgcaggccagcaacagtggtctaaagcctcaacatgcaaattga

DBGET integrated database retrieval system