KEGG   Gallus gallus (chicken): 416765Help
Entry
416765            CDS       T01006                                 

Gene name
CLTCL1
Definition
clathrin, heavy chain-like 1
Orthology
K04646  
clathrin heavy chain
Organism
gga  Gallus gallus (chicken)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    416765 (CLTCL1)
   04142 Lysosome
    416765 (CLTCL1)
Exosome [BR:gga04147]
 Exosomal proteins
  Proteins found in most exosomes
   416765 (CLTCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
15
AA seq 1679 aa AA seqDB search
MAQILPIRFQEHFQLQSLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMSDPAT
PIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMAEEVIFWKWISVNTVA
LVTETAVYHWSMEGESQPQKMFDRHASLAGCQIINYRTDEHQKWLLLIGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAEFKIEGNAKPSTLFCFAVRSPAGGKLHIIEVGQPATGN
QPFVKKAVDVFFPPEAQTDFPVAMQIGIKHGVIYLITKYGYIHVYDLESGVCIYMNRISA
DTIFVTASHEPTSGIIGVNKKGQVLSVCVEEDNIVNYATNVLQNPDLGLRMAIRSNLAGA
EELFARKFNTLFAQGSYADAAKVAASAPKGILRTSDTIRKFQSVPAQPGHASPLLQYFGI
LLDQGQLNKFESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKTADPTLALSVYL
RANVPNKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRSVMRVSPEQGLQFSQMLVQDE
EPLANINQIVDVFMENSLIQQCTSFLLDALKNNRPAEGHLQTRLLEMNLIHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSVECLRAMLSANIRQNLQLCVQVASKYHEQLGTQSLVELFESFKSYEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNSLQKYIEIYVQKVNPSRIPAVVGGLLDVDCSEDVIKNLIMVVRGQF
STDELVAEVEKRNRLKLLLPWLESRIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELIKVCNENSLFKSEARYLVRRKDPELWANVL
EENNPFRRQLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELYEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLARAQLQKDLVKEAIDSYIKADDPSAYMEV
VQAANRNDNWEDLVKFLQMARKKARESYVETELIFAFAKTNRLSELEEFISGPNNAHIQQ
VGDRCYEEGMYEAAKLLYNNVSNFARLASTLVHLGEYQAAVDSGRKANSTRTWKEVCFAC
VDGREFRLAQICGLHIVIHADELEELISYYQDRGYFEELIALLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWREGQFKDIIAKVANVELYYKALQFYLDYKPLLINDLLLVLSPRLDHTRTVNFFS
KVNQLLLVKPYLRSVQNHNNKGVNEALNNLLTEEEDYQGLRASIDAYNNFDNITLAQRLE
KHELIEFRRIAAYLYKGNNRWKQSVELCKKDHLYKDAMQYAAESKDVELAEKLLQWFLEE
GKQECFAACLFTCYDLLHPDVVLELAWRHNIMDFAMPYFIQVMREYLTKVDGLFYKVDNL
DASESLRKEEEQVTEPTPIVFGQQLMLTAGPSAVPPQTNFPYGFTAPGFTQPPVYGFNV
NT seq 5040 nt NT seq  +upstreamnt  +downstreamnt
atggcccagatcctgcccattcgcttccaggagcacttccagctccaaagtttgggtatt
aacccagcaaacattggattcagcaccctaacaatggaatctgacaagttcatttgcatc
agagagaaagtgggagagcaggcacaagtagtaataattgacatgagtgatccagcaaca
cccatcagacgtccaatttctgctgaaagtgccataatgaatccggcctctaaagtaatt
gcactaaaagctgggaaaacacttcagatctttaacattgagatgaaaagtaaaatgaaa
gcccacaccatggcagaggaggtgatcttctggaaatggatatctgtgaatacagttgcc
ttggtgacagagacagcagtttaccactggagcatggagggagaatctcagccccaaaag
atgtttgacagacacgctagtcttgcaggctgccaaatcatcaattatagaactgatgaa
catcaaaaatggctgttgctgataggaatttcagcacagcaaaatcgtgtggttggtgca
atgcagctgtactctgttgatagaaaagtctcccagcctatagagggccatgcagcagct
tttgcagaattcaaaatagagggaaatgccaaaccttccacactcttttgttttgctgtg
aggagtcctgcaggaggcaagcttcacataattgaagtgggtcaaccagctactggaaat
cagccatttgttaagaaagctgttgatgtatttttcccacctgaggcacagacggacttt
cctgtggcaatgcagattggaattaagcacggtgttatctacctgatcacaaaatatgga
tatattcacgtgtatgacttggagtctggagtttgcatctacatgaaccgtattagtgcc
gacactatttttgtcacagcttctcatgaacctacctcaggcattattggtgtcaacaaa
aaaggacaggtgctttctgtatgtgttgaggaagacaacattgtgaactatgctacaaat
gttctccagaatcctgacttgggcctgcgtatggctatacgtagtaatcttgctggtgca
gaggaattatttgccagaaagtttaacacgctgtttgctcaaggaagctatgcagatgct
gctaaagtagctgcatctgcaccaaagggaattctacgtaccagtgatacaatcaggaag
ttccagagtgtaccagctcagccagggcatgcgtctcccctgctccagtactttggaata
ttgcttgatcagggacagctgaacaaatttgagtctcttgagctctgtcgccctgttctg
cagcaaggccgcaagcagcttctggagaaatggctgaaggaagacaagctggagtgttca
gaggagctgggagacttggtgaagacagctgacccaacccttgcacttagtgtctatctt
cgtgctaatgtgccaaacaaagtgattcagtgctttgctgaaactggtcaattccagaaa
atagtactgtatgctaaaaaggttggatataccccagactggatcttcttgctgagaagt
gtgatgagagtcagtcctgagcagggtctgcagttttctcagatgctggtacaggatgag
gagccactggctaacattaaccagattgtggatgtgttcatggagaacagtcttattcag
caatgcacatcctttctgttggatgctttgaaaaataaccgcccagcagaaggccacctt
cagactcgtctgctggaaatgaatttgattcatgccccacaggttgcagatgccatcctt
ggaaaccaaatgtttacgcactatgatcgtgctcatattgcccagttatgtgaaaaggca
ggcttgctccagcgagctttggagcactacactgatctctatgatattaaacgtgctgtc
gttcatactcatctcttgaatcctgagtggcttgtgaatttctttggctctctctctgtt
gaagactctgtagaatgcttgcgtgctatgctgtcagccaacattaggcaaaacctacaa
ctctgtgtacaggttgcttctaagtaccatgagcagcttggcacccagtctcttgtggag
ctttttgaatctttcaaaagctatgaaggactgttctatttcttgggttccattgtaaac
ttcagtcaggatccagatgttcacttcaaatatatccaggcagcttgcaagactggtcag
ataaaggaagtagaaagaatctgccgtgaaagtaactgctataacccagaaagggtgaaa
aactttctgaaggaggcaaagctgacagaccagcttcctctgatcattgtctgtgatcga
ttcgactttgttcatgacctggtgctctacttatatcgcaatagcctgcagaagtatata
gagatctatgtacagaaggtgaaccccagccgcataccagcagtggttggagggcttctt
gatgtggattgttctgaagatgtcattaagaacttgatcatggtggttagaggccagttc
tcaacagatgagctggtggctgaagtggaaaaaagaaatcggcttaaattgctgttgcca
tggcttgaatcaaggattcatgaaggctgtgaagaacctgcgactcataatgccttggcc
aaaatctacattgacagtaataataatccagagcggttccttcgtgagaatccgtactat
gacagtcgtgtagttggcaaatactgtgaaaagagagaccctcatctggcctgcgttgca
tatgagaggggccagtgtgatctggaactcataaaggtttgcaatgagaactcactattt
aagagtgaggctcgctacctagtacgcaggaaggaccctgaactctgggcaaatgttcta
gaagaaaacaacccattcaggcgccagcttattgaccaggttgtccaaacagctttatca
gagacacaggatccagaggaggtttctgtcactgtgaaagctttcatgactgcagacctg
ccgaatgaattaattgagttattggaaaaaattgtcttggataattctgtattcagcgaa
cacaggaatctccagaatctgctgatcctgactgccattaaggctgaccgcactcgtgta
atggaatacattaatcgactggataactatgatgccccagatattgcaaacattgccatc
agtaatgagctgtatgaagaagcctttgctatattcagaaaatttgatgttaatacttca
gcagttcaggtgctgattgagcacattgggaatttagaccgtgcttatgaatttgcagag
agatgtaatgagccagcagtatggagccagctagccagagcacagctgcagaaagacttg
gtaaaagaagctattgactcctatataaaggcagatgacccatctgcctacatggaagtt
gttcaagcagctaatagaaacgacaactgggaggacctagtcaagttcttgcagatggcc
aggaagaaggctagagagtcttatgtagagacagaacttatttttgcctttgcgaaaact
aatcgtctctcagaactggaggaatttattagcggccctaataatgcccatatacagcag
gttggtgatcgttgttatgaagagggtatgtatgaagcagcaaaactactctataacaat
gtatccaactttgctcgcttggcatctacattggtgcaccttggggagtatcaggcagca
gtggacagtggccgtaaggccaacagcacaaggacttggaaggaggtatgttttgcctgt
gtggatggaagagaattccgcttggcacagatatgtggcttgcacatagtcatccatgct
gatgaacttgaagagctgattagttactatcaggatcgtggctactttgaagagctgatt
gcccttctggaagctgctttgggcctagagcgtgctcacatgggaatgtttactgaactt
gccatcttatactccaaatttaagcctcagaaaatgagggaacatctggaactcttctgg
tctagagttaatattccaaaggtgctcagagctgcagaacaggctcatctctgggcagaa
cttgtattcctctatgacaaatatgaggagtatgacaatgcaataattactatgatgaat
catcccactgatgcctggagggaaggacagtttaaagacataattgccaaggtggcgaac
gtggagctatattacaaagccttgcagttctacttagactacaaacctctgctgatcaat
gatcttctgcttgtattatctccacgactggatcacaccaggacagtcaattttttctcg
aaggttaatcagctgcttctagtaaagccttatttgcgttcagtgcaaaaccacaataat
aaaggagttaatgaagctctaaacaaccttttaacagaggaggaggactaccagggtttg
agagcttccattgatgcctacaacaactttgataacataactttggctcagcgtctggaa
aagcatgagctaattgaatttaggcgtattgcagcatacttgtataagggtaacaatcgc
tggaagcagagtgtggaactatgcaagaaagaccatctgtataaggatgctatgcagtat
gctgcagagtccaaagatgtagaactagcagaaaagctgcttcagtggttcctggaagaa
ggcaagcaggagtgttttgcagcctgccttttcacatgttacgacttgctgcacccagat
gtagtccttgaattggcatggaggcataatatcatggacttcgcaatgccttatttcatc
caagtgatgagagagtacctcaccaaagttgatgggctgttctataaggtggataatctt
gatgcttctgaaagcctaagaaaagaagaggaacaagtaactgaacctactccaatagta
tttggccagcagttgatgttaacagcaggccccagtgcagtaccgccccagacaaacttt
ccatatggattcacagcaccaggattcacccagccacctgtttatggtttcaatgtgtaa

DBGET integrated database retrieval system