KEGG   Gallus gallus (chicken): 416783Help
Entry
416783            CDS       T01006                                 

Gene name
COMT
Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
gga  Gallus gallus (chicken)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    416783 (COMT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    416783 (COMT)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     416783 (COMT)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   416783 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
15
AA seq 262 aa AA seqDB search
MLESSSVLLFIVFVLLFISLLFVVLIRKNGTAALIWHEIIKEKITNFIMNQSKERRILNF
VLQNAVRGDPCSVMETIDKYCSEKEWAMNVGDVKGVILDKTVEEINPKVALELGTYCGYS
AVRIARLLKAGACLLTVEFNPEFAAIAKQMIEFAGVQDKVKLLEGPSEVIIPQLKKKYEV
DTLDFVFVDHWKDRYAPDTILLQECSLLRKGSVLLADNIIFPGAPEFVKYIRNNPRFQCS
TYPSYLEYMKVQDAMEKAVFLG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgctggagagctcttcagtccttttgttcattgtcttcgttctgcttttcatttcgttg
ctcttcgtggtactcatcaggaaaaatggcactgctgccctgatctggcatgaaataatc
aaggagaaaataaccaatttcatcatgaatcagagcaaagaacggaggattttaaatttt
gtgttgcagaatgcagtccgaggggacccctgcagtgtgatggaaactatagataaatac
tgctctgagaaagagtgggccatgaatgtgggcgatgtaaaaggtgtaattctggacaag
acagtggaagagatcaatcctaaagttgcactggagctgggaacatactgtggctactca
gctgttaggattgctcggctgctgaaagcaggcgcttgtcttctcactgtggagttcaac
ccagaatttgctgctatagctaaacagatgattgagtttgctggagtacaagataaggta
aaactcctagaaggcccttcagaggtaatcatcccgcagctgaaaaaaaaatatgaagtg
gatactctggattttgtcttcgtggaccactggaaagacagatatgcaccagacaccatc
ctgcttcaggaatgcagcttgctgcggaagggctcagttcttctggctgacaatatcatc
ttcccaggagctcctgaatttgttaaatatatccgcaacaacccccgtttccaatgcagt
acctacccatcttatctggaatatatgaaagtgcaggacgctatggaaaaggctgtgttt
ttgggataa

DBGET integrated database retrieval system