KEGG   Gallus gallus (chicken): 416825Help
Entry
416825            CDS       T01006                                 

Gene name
SETD8
Definition
SET domain containing (lysine methyltransferase) 8
Orthology
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
gga  Gallus gallus (chicken)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:gga00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
15
AA seq 394 aa AA seqDB search
MSIKLINSDSSVMLQTINRGRDDRTVGRDEKNRLNGAHVPATALCMLHIKAQRSAVMCST
FSTESICTSPYDRGQKVAVYGHSRLGEENVFTGQSKIYSYLNPNKSPGARSPLQEENSVM
YHEVKCQGKALTETNRKGDEKKNGGNIIEGAMKPEDQKDKESGCNTSVLSSDQKKQETVE
TEKTLLPSDCAGEASAKPAQKKMVKAKRGPRRKTQGRAPNRKVTDYYPVRRSSRKSKSEL
ETEERRKIDELITSGKEEGMKIDYIDGKGRGVIATKHFNRGEFVVEYHGDLIEITDAKKR
EAVYAQDPSTGCYMYYFQYLSKTYCVDATKETNRLGRLINHSKCGNCQTKLHDIDGVPHL
ILIASRDIKAGEELLYDYGDRSKASIEAHPWLKH
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattaaactgattaattcagattcatcagtgatgcttcagacaataaacagagga
agagatgacagaactgtgggcagagatgagaagaaccgtttaaatggagctcatgtccca
gctactgccctctgcatgcttcacataaaggcacagagaagtgcagtcatgtgcagcacg
tttagcactgaaagcatctgtacatctccgtatgatcgtggccagaaagtagcagtgtat
ggtcattctcggctgggagaggagaatgtgtttactggtcaatccaaaatctacagctac
ttgaatcccaacaaatctcctggtgctcgctccccacttcaagaagaaaactctgtcatg
tatcacgaagtgaaatgtcagggcaaagcgctaactgaaaccaacagaaaaggagatgaa
aaaaagaatggtggcaatataattgaaggtgctatgaaaccagaagaccagaaagataag
gaaagcgggtgcaatacttcagtgctctcttctgatcaaaaaaaacaagaaactgtagaa
actgagaagacgctcctgccctcagactgtgctggtgaggccagtgcaaagccagctcag
aaaaagatggttaaagcaaaacgtggaccaaggaggaaaacacaaggaagagcaccaaat
cgaaaagtgacagactattacccagtcagaagaagttccaggaagagcaaatctgaactg
gagactgaggaaaggaggaaaatcgatgaactaattacaagtgggaaagaagaaggaatg
aagattgattacattgatggcaaagggagaggagtaattgctactaaacattttaatcgt
ggagaatttgtagttgaatatcatggagatctcatagagatcactgatgctaaaaagcgg
gaggctgtgtatgctcaagatccatccacaggctgctatatgtactattttcagtacctc
agcaaaacgtactgtgttgatgctacaaaagaaactaatcgtctgggaagactgattaat
cacagcaaatgtggcaattgtcaaacaaagcttcatgacattgatggcgtgcctcatctc
atattgatagcttccagagacattaaagcaggtgaagaactgttgtatgactatggagac
agaagcaaagcttccattgaagctcatccatggctaaaacactaa

DBGET integrated database retrieval system