KEGG   Gallus gallus (chicken): 416825Help
Entry
416825            CDS       T01006                                 

Gene name
SETD8
Definition
SET domain containing (lysine methyltransferase) 8
Orthology
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
gga  Gallus gallus (chicken)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    416825 (SETD8)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     416825 (SETD8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
15
AA seq 394 aa AA seqDB search
MSIKLINSDSSVMLQTINRGRDDRTVGRDEKNRLNGAHVPATALCMLHIKAQRSAVMCST
FSTESICTSPYDRGQKVAVYGHSRLGEENVFTGQSKIYSYLNPNKSPGARSPLQEENSVM
YHEVKCQGKALTETNRKGDEKKNGGNIIEGAMKPEDQKDKESGCNTSVLSSDQKKQETVE
TEKTLLPSDCAGEASAKPAQKKMVKAKRGPRRKTQGRAPNRKVTDYYPVRRSSRKSKSEL
ETEERRKIDELITSGKEEGMKIDYIDGKGRGVIATKHFNRGEFVVEYHGDLIEITDAKKR
EAVYAQDPSTGCYMYYFQYLSKTYCVDATKETNRLGRLINHSKCGNCQTKLHDIDGVPHL
ILIASRDIKAGEELLYDYGDRSKASIEAHPWLKH
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattaaactgattaattcagattcatcagtgatgcttcagacaataaacagagga
agagatgacagaactgtgggcagagatgagaagaaccgtttaaatggagctcatgtccca
gctactgccctctgcatgcttcacataaaggcacagagaagtgcagtcatgtgcagcacg
tttagcactgaaagcatctgtacatctccgtatgatcgtggccagaaagtagcagtgtat
ggtcattctcggctgggagaggagaatgtgtttactggtcaatccaaaatctacagctac
ttgaatcccaacaaatctcctggtgctcgctccccacttcaagaagaaaactctgtcatg
tatcacgaagtgaaatgtcagggcaaagcgctaactgaaaccaacagaaaaggagatgaa
aaaaagaatggtggcaatataattgaaggtgctatgaaaccagaagaccagaaagataag
gaaagcgggtgcaatacttcagtgctctcttctgatcaaaaaaaacaagaaactgtagaa
actgagaagacgctcctgccctcagactgtgctggtgaggccagtgcaaagccagctcag
aaaaagatggttaaagcaaaacgtggaccaaggaggaaaacacaaggaagagcaccaaat
cgaaaagtgacagactattacccagtcagaagaagttccaggaagagcaaatctgaactg
gagactgaggaaaggaggaaaatcgatgaactaattacaagtgggaaagaagaaggaatg
aagattgattacattgatggcaaagggagaggagtaattgctactaaacattttaatcgt
ggagaatttgtagttgaatatcatggagatctcatagagatcactgatgctaaaaagcgg
gaggctgtgtatgctcaagatccatccacaggctgctatatgtactattttcagtacctc
agcaaaacgtactgtgttgatgctacaaaagaaactaatcgtctgggaagactgattaat
cacagcaaatgtggcaattgtcaaacaaagcttcatgacattgatggcgtgcctcatctc
atattgatagcttccagagacattaaagcaggtgaagaactgttgtatgactatggagac
agaagcaaagcttccattgaagctcatccatggctaaaacactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system