KEGG   Gallus gallus (chicken): 416825Help
Entry
416825            CDS       T01006                                 

Gene name
KMT5A, SETD8
Definition
(RefSeq) lysine methyltransferase 5A
  KO
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
gga  Gallus gallus (chicken)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    416825 (KMT5A)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     416825 (KMT5A)
Chromosome [BR:gga03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     416825 (KMT5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Position
15
AA seq 359 aa AA seqDB search
MTAGSGAGHGSDATLTSSLLGRNMPKARAGGAEKANPENAERKSPGRSRAGGENVFTGQS
KIYSYLNPNKSPGARSPLQEENSVMYHEVKCQGKALTETNRKGDEKKNGGNIIEGAMKPE
DQKDKESGCNTSVLSSDQKKQETVETEKTLLPSDCAGEASAKPAQKKMVKAKRGPRRKTQ
GRAPNRKVTDYYPVRRSSRKSKSELETEERRKIDELITSGKEEGMKIDYIDGKGRGVIAT
KHFNRGEFVVEYHGDLIEITDAKKREAVYAQDPSTGCYMYYFQYLSKTYCVDATKETNRL
GRLINHSKCGNCQTKLHDIDGVPHLILIASRDIKAGEELLYDYGDRSKASIEAHPWLKH
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgggcagcggtgcgggacacggctcagatgccactcttacttcctcgctccta
ggcaggaacatgcccaaggccagggcgggcggcgcggagaaggcgaaccccgagaacgcc
gagaggaagagccccggccgctcccgagccggtggggagaatgtgtttactggtcaatcc
aaaatctacagctacttgaatcccaacaaatctcctggtgctcgctccccacttcaagaa
gaaaactctgtcatgtatcacgaagtgaaatgtcagggcaaagcgctaactgaaaccaac
agaaaaggagatgaaaaaaagaatggtggcaatataattgaaggtgctatgaaaccagaa
gaccagaaagataaggaaagcgggtgcaatacttcagtgctctcttctgatcaaaaaaaa
caagaaactgtagaaactgagaagacgctcctgccctcagactgtgctggtgaggccagt
gcaaagccagctcagaaaaagatggttaaagcaaaacgtggaccaaggaggaaaacacaa
ggaagagcaccaaatcgaaaagtgacagactattacccagtcagaagaagttccaggaag
agcaaatctgaactggagactgaggaaaggaggaaaatcgatgaactaattacaagtggg
aaagaagaaggaatgaagattgattacattgatggcaaagggagaggagtaattgctact
aaacattttaatcgtggagaatttgtagttgaatatcatggagatctcatagagatcact
gatgctaaaaagcgggaggctgtgtatgctcaagatccatccacaggctgctatatgtac
tattttcagtacctcagcaaaacgtactgtgttgatgctacaaaagaaactaatcgtctg
ggaagactgattaatcacagcaaatgtggcaattgtcaaacaaagcttcatgacattgat
ggcgtgcctcatctcatattgatagcttccagagacattaaagcaggtgaagaactgttg
tatgactatggagacagaagcaaagcttccattgaagctcatccatggctaaaacactaa

DBGET integrated database retrieval system