KEGG   Gallus gallus (chicken): 416844Help
Entry
416844            CDS       T01006                                 

Gene name
MIR7107, FBXL10, KDM2B
Definition
(RefSeq) microRNA 7107
  KO
K10276  
F-box and leucine-rich repeat protein 10/11 [EC:1.14.11.27]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone-H3]-lysine-36 demethylase
     416844 (MIR7107)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     416844 (MIR7107)
Chromosome [BR:gga03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    416844 (MIR7107)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Position
15
AA seq 1289 aa AA seqDB search
MKLSEKMKTEKDSGRRLRPIGRRRYDEHEDLSDVEEIVSVRSFNLEEKLKSKTYRGDFVH
SMDGKDFTFEYVQREALRVPLIFRNKDGLGIKMPDPDFTVRDVKLLVGSRRIVDVMDVNT
QKGVEMSMSQFVRYYETPEAQREKLYNVISLEFSHTKLENIVKRPNVVDLVDWVDNMWPQ
HLKERQTDATNAISEMKYPKVKKYCLMSVKGCFTDFHIDFGGTSVWYHVFRGGKIFWLIP
PTLQNLELYEEWVLSGKQSDIFLGDRVERCQRIELKQGYTFFIPSGWIHAVYTPVDSLVF
GGNILHSFNVPMQLRIYEIEDRTRVHAKFRYPFYYEMCWYVLERYVSCVTQRCHLSKEYQ
KESMLIDAKRKRSIDSYSSDSWLDMDEESCDAHIREEKDDSLDKNSKSLVDGSSSPNSTH
SEGKEGAGRKQKATVMRYLKRTLSNESDDSVKSTTPTDYPKTPTGSPATEVSTKWTHLTE
FELKGLKALVEKLESLPENKKCVPEGIEDPQALLEDMKNILKEHADDDQNLAISGVPVVS
WPKKTPKNRAVGRPKGKLGAASAVKLAANRTTAGARRRRTRCRKCEACLRTECGECHFCK
DMKKFGGPGRMKQSCIMRQCIAPVLPHTAVCLVCGEAGKEDTVEEEESKFNLMLMECSIC
NEIIHPGCLKVKESDGVVNDELPNCWECPKCNHAGKTGKAYKQKRGPGFKYASNLPGSLL
KEQKMNRDNKEVTDAAKRKGDCEETPRRKSEEHSKKPQVDSILRRKSDEVHLRRKRKFEK
PQEPSMRKRRRSWKASDERTALLKPLRRLKQEPEDELPEAPPRSKDSDQSRSSSPTAGPS
TEGAEPRDKKKFKMRRKRRLPNKELSKELSKELNQEIQKTENSLANENHQPIKSEPESEN
EEPKRALNNSERLHRFSKGLNGTPRELRHPLIPSLRSTPRGIARPPPSLSPPKCIQMERH
VIRPPPISPPPDSLPLDDGAAHVMQREVWMAVFSYLSHRDLCICMRVCKTWNRWCCDKRL
WTKIDLNHCKSITPLMLSGIIRRQPVTLDLSWTNISKKQLSWLINRLPGLRDLLLSGCSW
IAVSALCSSSCPLLRTLDVQWAEGLKDAQMRDLLSPPTDNRPGCNGCTLESMETLSSSSG
KEQFCGSCHIRPDISSGQIDNRSKLRNIVELRLAGLDITDASLRLIIRHMPLLSKLNLSY
CNHVTDQSINLLTAVGTTTRDSLTEINLSDCNKVTDQCLSYFKRCGNICQIDLRYCKQVT
KEGCEQFIAEMSVSVQFGQVEEKLLQKLS
NT seq 3870 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctccgaaaaaatgaagacggagaaggactctggaagaagattgcggcccatt
ggcaggaggaggtacgatgagcacgaggacctctcggacgtggaggaaatcgtcagcgtc
aggagtttcaatctggaggagaaattaaagagcaaaacgtaccgcggggatttcgtgcac
tctatggacgggaaagattttacttttgagtatgtgcaaagagaagctctcagagttcca
cttatcttcagaaataaggatggactgggaattaaaatgcctgacccggatttcaccgtc
agagatgtgaagctattagtgggaagccgtcgaatagtggatgtgatggatgtgaacacg
caaaaaggtgtggaaatgagcatgtcccagtttgtgaggtactatgaaacaccagaggcc
cagcgtgaaaaactctacaatgtcatcagcttggagttcagtcacacaaagctggagaac
attgtcaagcgtcccaatgtggtggacttagtcgactgggtggataatatgtggccacag
catttgaaggagagacagacagatgctaccaatgctatttcagagatgaaataccccaaa
gtgaaaaagtactgtttgatgagtgtgaaaggatgcttcactgatttccatattgatttt
ggaggcacttcagtgtggtatcacgttttccgtggggggaagatcttctggctgattcca
cctactctgcagaatctagaactttatgaagaatgggttctctcaggaaagcaaagtgat
atctttctgggagacagagtggaacgatgccaaagaattgaactgaaacaaggctataca
ttcttcattccttcagggtggatacatgcggtttatactccagtagattctctggtgttt
ggtggaaatatcctgcatagctttaatgttcccatgcagcttcgcatctatgaaattgag
gacagaacaagggtgcatgccaaattccgttatcctttctactatgaaatgtgctggtat
gttctggagagatacgtgtcctgtgtgacccagcgctgccacctcagcaaagagtaccag
aaagaatcaatgttaattgatgcaaagagaaaacgcagcatagacagctattcatcggat
tcgtggttagacatggatgaagaatcttgtgatgctcatatccgggaggaaaaggatgac
agcttggataagaactccaaatccctggtggatggctcctcctcacccaacagcacacat
tcagaaggaaaggagggtgcagggagaaaacaaaaagccacagtaatgaggtacctaaaa
agaactttgtctaatgagtcagatgacagtgtaaaatcaacgacccccacggattatccc
aaaacaccaacggggtctccagctacagaagtttcaaccaaatggactcacctcacagaa
tttgaactgaagggtttaaaagccctggtggaaaagcttgaatctctcccagagaacaag
aagtgtgttccagaaggcattgaggatccacaggctctcctggaggacatgaagaacatt
ctgaaagaacatgctgatgatgaccaaaatcttgcgatttcgggtgtccctgtggtcagc
tggcccaagaagaccccaaagaacagggcggtgggacggcccaaagggaagctgggcgct
gcctctgcggtgaagctcgcagctaaccggaccacggccggagcacgccggaggaggacg
cgatgccgcaagtgcgaggcgtgcctgcggacagagtgcggcgagtgtcacttctgcaaa
gacatgaagaagtttggggggcctggcaggatgaaacagtcctgcattatgaggcagtgt
atcgcaccggtgttgcctcatactgctgtatgtctggtgtgtggagaagctgggaaagag
gacactgtggaagaggaggagagcaagtttaatctcatgctaatggaatgctccatttgt
aatgaaataatacacccaggatgccttaaggtgaaggaatcagatggtgtggttaatgac
gagctgccgaactgctgggagtgtccaaagtgcaaccatgcagggaaaactggaaaagcg
tacaagcaaaagcgcggaccaggattcaaatacgcatcaaatctcccaggctcattgctg
aaggaacagaaaatgaacagagacaataaggaagtaacagatgctgcaaaacggaaaggg
gactgtgaagaaactcccaggcggaaatctgaggaacattccaaaaagcctcaagttgac
tcaattctgaggagaaagtcagacgaagtacatctgcggaggaaaaggaaatttgagaaa
ccccaggaaccctctatgagaaaacggcggcgatcgtggaaggcttcggatgagcggacc
gccctgctcaaacccctgcggcgcctcaaacaggagccggaggacgagctgccggaagca
cctccccggtccaaggacagcgaccagtcgcgatccagctcgcccaccgcgggtcccagc
acagagggggccgagcccagggacaagaagaagttcaagatgaggcggaaaaggcggctt
cccaataaggaactgagcaaggagctcagcaaggagctcaaccaagagatccaaaaaacc
gagaatagccttgccaatgagaatcaccaacccatcaaatctgaacccgagagcgaaaac
gaggaacccaagcgcgccttgaacaacagcgagagactccataggttcagcaaagggttg
aacgggactccccgggagctgaggcacccgctcatccccagcctgcggagcacgccgcgg
ggcatcgcccggcccccgccctcgctctcccctcccaaatgcattcagatggagcggcac
gtcatccggccgccccccatcagcccccctccggactctctccccctggatgatggggca
gcccacgtgatgcagagggaagtctggatggctgtctttagctacctcagtcatagagac
ttgtgcatctgtatgagagtttgcaagacctggaacagatggtgctgtgacaaaagatta
tggaccaaaatagatttaaaccattgtaaatccatcactccacttatgcttagtggcatt
attaggagacagcctgtaacccttgatcttagctggacaaatatatctaaaaagcagctg
agctggcttatcaacagactgccaggtcttcgagacctgctgttatcagggtgctcatgg
atagcagtgtcagcactttgtagttccagctgtcctttactccgaactctggacgtgcag
tgggcagaaggactgaaagacgctcagatgagagacctcctgtcaccgcccacagataac
cggccaggctgcaacgggtgtactttagagagtatggaaacactttcttccagttcaggg
aaggagcagttctgtgggtcatgccacattcgcccggatatcagctcaggtcagatcgac
aaccggagtaaactacggaacatcgttgaactgcgcttggccggcctggatattaccgat
gcgtctttgcggctgatcataaggcacatgcctctgctctccaaactcaatcttagttac
tgtaaccacgtgacagatcagtctattaacctgctgaccgcggttggaactaccacgcgg
gattcattaacggaaattaatttatcagactgcaataaggtgactgaccagtgcctgtcc
tacttcaaacgttgtggaaacatctgccagatcgacttgaggtactgcaagcaagtgaca
aaagaaggctgtgagcagttcatagcagagatgtcagtaagtgttcagtttgggcaagtg
gaagaaaaacttctgcaaaaactgagttag

DBGET integrated database retrieval system