KEGG   Gallus gallus (chicken): 416851Help
Entry
416851            CDS       T01006                                 

Gene name
SETD1B
Definition
SET domain containing 1B (EC:2.1.1.43)
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
gga  Gallus gallus (chicken)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    416851 (SETD1B)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     416851 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
15
AA seq 2008 aa AA seqDB search
MSFREIKAGEKAKHPEDHGKKQSSSWINGMENSTQASTSVEKRNHHWRSYKLIIDPALKK
GQHKLYRYDGQHFSMPNSGIAPVDCVRDPRIGRIWTKTKELELSVPKFKIDEFYVGPVPP
KQVTFAKLNDNIRENFLTDMCKKYGEVEEVEILYNPKNKKHLGIAKVIFATVKGAREAVQ
HLHNTSVMGNIIHVELDTKGETRMRFYELLVNGLYTPQTLPVGTEQDASPTVNETLQLTD
SLKRLKDSNLSSVGSSVTPNSSTPFSHDTAYSSCRQDTPNSFSQFTPQSQGTPHTPRLGT
PFSQDSTYSSRQTTPVYHFGQDSGYKHRRHETKFTDAYNRRPGGHHYVHNSPGVFRGTEH
QFSTFKSHQQEPVQFSHTPPLSHSSSSSYKSAFSPYQAPAVFPQSEEQPFAQTSREAEYR
RPAPPPAEMVVESSAATSADFAPVKEKPEEPPPLPDSNSAPEPSAPSFSQTPERSETPGT
PTMESEMQHNSLDSRIEMLLKEQRTKLPFLNEHDSDNEVRMEGSPISSSSSQLSPIPMYG
SNSQPGYRAQTPSSRPSSTGLEDISPTPLPDSDDDEPIPGTASLNQNSRGTSEASMTPID
QLNRASKVETLEVKEMVPGDQTPTSEKMDESQHSSGEDMEISDDEMNSAPITSAECAKTI
VVNSSVSNAAVMAPSIPPLPPPPGFPPLPPPPPPPPQPAFPMPPPLPPPPPPTHPAVTVP
PPPLPAPPGVPPPHILPPLPPFHPGMFPVMQVDMISVLGNHWGGMPMSFQMQTQMLSRMM
QAQNTYQYPPFMGGRMQFVNLPPYRPFSMGAARGRGQQWPPLPKFDPSVPPPGYEPKKED
PHKATVDGVLLVIVKELKAIMKRDLNRKMVEVVAFRAFDDWWDKKERLAKASLTPVKSGG
ELEEKPKPKDRITSCLLENWNKGEGLGYEGIGLGIGLRGAIRLPSFKVKRKEPPEAASAG
DQKRIRPSTSVDDEDEESERDRDASDTTSDLSKKDAEAVGLRRRPARPLELDSEGEEGDE
TSGKEEESSSEKEEEQEEEGGLVKAAPGKEEEEDEDDEEDEDDDEDEEDEEDYEETGVET
SDKEEEQDSEEEDAASPSSSKAEVESSDESEDSSEFESSSDSDEDDDEEEEEEEDEEEEE
EEEVAEDQDREAMVAETEHEPASHELPDDKRETILELYPVDYMDATGLGLSEPALVEKDE
GMEEVKAEESECDQVPEESIAAETLKQLVMERDQETKLALSPICRPVEEPEPIVMLEPEV
QECPKPESQDEAGTVCLSTPVAVFGEARPSKSSFFSKSDDSCLETHVKTKLPSAVEEEDR
LPRTPGREVVVHSETDILLLPAHKVPSSTVPLPSTPGKEESVVPPEKFPEQLMVTKTSIE
EEIPRTPGRDILAKSSHPLGKSQSTDTVPATPGSDAPLTGSSLTLSSPQVPGSPFSYPSQ
SPGINSGIPRTPGRDFNFTPTFPEAGATIPCLLSGKKQSEDDLDEKPFKEPLGASLTISM
NSVPSPIPFASPTQADFRTDMGLPPNEPIPIAALPCIPGDGRMPIEECKAEVKSVLLSPE
APVGASILPPPPPHSVLPKRRPGRPRRSPPSVLSLDMYSGKTIEPPPVPVALVESAMSKE
LLSAHPDAFYGLKDPEAVTLDFRNDSFHEKIAAETVAEKLPFKELENQWNEDFKEEEAHA
KPKRQWRRQKKSPEHLPVIPSPEYSPPQPQFRPRSEFEEMTILYDIWNGGIDEEDIKFMC
ITYDRLLQQDNGMDWLNDTLWVFHPSTSFSTPKKKKRDDGMREHVTGCARSEGYYKIDKK
DKLKYLNNSRAFAEEPPADTQGMSIPAQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLK
FNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGI
GSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEE
ITYDYKFPIEDVKIPCLCGSENCRGTLN
NT seq 6027 nt NT seq  +upstreamnt  +downstreamnt
atgtctttccgagagatcaaggcgggggaaaaagccaagcaccctgaagatcatggcaaa
aagcagagttcaagttggatcaacggaatggagaacagcacccaagccagcacttctgtc
gagaaaagaaatcaccattggagaagttacaagttgattattgacccggctctgaaaaaa
ggacagcacaaactctaccgctacgatgggcaacatttcagcatgccgaactcgggaatc
gctcctgtggattgtgtcagggatcccagaatagggcgaatatggaccaaaacgaaggag
ttggagctgtctgtccccaaattcaagattgatgagttttacgtggggccagtgcctccc
aagcaggtcacctttgccaagctgaatgacaacatccgtgaaaactttttaaccgacatg
tgcaagaaatacggtgaagtggaagaggtggagattctctacaaccccaagaacaagaag
cacctgggcatcgccaaagtgatttttgccactgtcaaaggtgcccgggaggctgtccag
caccttcacaacacctctgtcatgggcaacatcatccacgtggagctggatacaaaaggt
gaaacccgcatgcgattctacgaactgctcgttaatggtctttacactcctcagaccctt
cccgtaggcactgaacaggatgcatcgccaactgtgaatgaaaccctccagttgacagat
tccctgaagcgcttgaaggacagtaacctttcctctgtgggatcatctgtcaccccaaac
agcagcacaccgttttcccacgacacagcctattccagctgtcggcaggacaccccaaac
tcgttcagtcaattcaccccgcagtcccaaggaacgccccacaccccacggttagggacg
ccgttttcccaggattccacgtattccagccgtcagacgacgccggtgtaccactttggg
caggacagtgggtacaaacacaggagacatgaaacaaaatttacagatgcctacaaccgt
cgaccgggaggacatcactatgttcataactctcctggtgttttccgtgggacagagcat
cagttcagtacgttcaaatcccatcagcaggagccagttcagttctctcacactcctccc
ctgagccactcgagttcttcgagttacaagtctgccttctctccttaccaagcaccagcc
gtattcccccagtctgaggagcagccgtttgcccaaacctccagggaagcagagtaccga
aggcctgcaccgcctcccgctgagatggtcgtagaaagcagtgctgccaccagcgctgat
tttgctccagtgaaggagaaaccggaggaacctccacccttaccagattcgaactctgct
cctgagccgagcgcaccatccttctctcagaccccagagaggagcgagacccctggcacc
cccactatggagtctgaaatgcagcataatagtttagactcaaggattgagatgctctta
aaagagcagagaacaaagttaccttttcttaatgagcatgactcagataacgaggtccga
atggaaggtagccctatctcctcttcctcttctcagctctctcccatcccaatgtatggt
tcgaattcacagcctggttacagagctcagacgccttcctcacgcccttccagcacaggc
ctggaggacatcagccccacgccattacctgactctgatgatgatgagcccatccctggg
actgcttctctgaatcagaattccagggggacatcagaggccagcatgacccccatcgat
cagctgaacagggcctccaaagttgagaccttggaggttaaagaaatggtgcctggtgac
cagactccaacatcggaaaagatggacgagagtcagcattcttcaggggaggacatggaa
atctccgatgatgagatgaactctgcgcctatcaccagtgcagagtgtgccaaaaccatt
gtggtcaactcctcagtcagcaacgcagccgtcatggccccatcaatccctcccctgccg
ccgccgcctggattccctcctcttcctcctcctccaccaccacctccacagccggctttc
ccgatgcctccgccactgcctcctccacctcctcccacacaccccgctgtcaccgtgccc
ccgccgccactccctgcaccgcctggggtccctccacctcacatcttgcctccgcttcct
cccttccatcccggcatgttcccagtcatgcaggtggatatgataagtgtcttgggcaac
cactggggtggcatgcccatgtccttccagatgcaaactcagatgctgagccgcatgatg
caggcacagaacacataccagtatccgcctttcatggggggcaggatgcagtttgtgaat
ctgccgccctaccgcccgttctcaatgggagcagctcgtggtcgtgggcagcagtggcca
ccactgcccaagtttgacccctcagttccaccgccgggttatgagcccaagaaggaagat
ccccacaaagccactgtggatggagtcctcctggtcatcgtgaaggaactgaaggctatc
atgaaaagggacctgaaccggaagatggttgaagtagtagcatttagggcatttgatgac
tggtgggacaagaaggaacggctggcaaaggcgtctctcactccagtgaagtccggagga
gaactggaggagaaaccaaagccaaaggatcgaatcacgtcttgtctcttggagaactgg
aacaaaggcgaaggcctgggatacgagggaattggcttgggcattgggttacgaggggcc
atccggttgccatccttcaaggtgaaaagaaaggagccaccagaagctgcctcagcagga
gatcagaagagaatccggccttctacttctgttgatgatgaagatgaagagtcggaaagg
gacagagatgcttctgatacaacatccgacctgtcgaagaaggatgcagaagcagtgggg
ctgaggcggcgaccagcacggccactggagctcgacagcgagggggaagagggagatgag
acatcagggaaagaggaagagtcttcctcagagaaagaagaggagcaggaggaagaagga
ggcttggtgaaagcagcacctggcaaggaggaagaggaggatgaagatgatgaggaagat
gaagacgatgatgaggatgaggaagatgaagaggattatgaggagacaggtgttgaaacc
agtgacaaagaggaagagcaggactctgaggaggaagatgcagcgagtccctcatcttcc
aaggctgaagttgaatcatcagatgaaagtgaggactcctccgaatttgaatcaagttct
gactcagatgaagatgatgatgaggaggaggaggaggaggaagatgaggaggaggaggaa
gaagaagaggtggctgaagatcaagacagagaagccatggttgcagagacagagcatgaa
cctgccagtcatgagcttcccgatgataagcgggagaccattttggagctctatcctgtg
gactacatggatgcaacgggcttgggactctcagagccagctttggtagagaaggatgaa
gggatggaagaagtcaaagcagaggaaagtgaatgtgatcaagtcccagaggaatctatt
gctgctgaaacactgaaacagttggttatggaaagagaccaggagacaaaacttgcactg
tctcccatctgcaggccagtggaagagcctgaacccattgtcatgctggagccagaggta
caagaatgcccaaagcctgaatcacaagatgaggctggcacggtctgtctctcaactcca
gtggcagtctttggagaagctcgccccagcaaaagcagcttctttagcaagtctgatgac
agctgcttagaaacgcatgttaaaacaaagctgccctctgcagtggaggaggaggaccgg
ctgcctcgcacacctgggcgggaagtggtggtccattcagagactgatattcttttgctt
ccagcccacaaggtgccatcctccacagttcccttaccatcgactcctggtaaagaggaa
tctgtagtccctccagaaaagtttcccgaacaattaatggtgaccaaaacgtccatagaa
gaggagattcctaggactcctgggcgggacattttggccaagtcttcacacccacttgga
aagtcgcagagcacagacactgttccagccacaccaggaagtgatgctccccttacggga
agcagcttaaccctcagttcccctcaagtcccagggagccccttttcctacccatcccag
tctcctggcattaacagtggcattcctcggactcctgggagagatttcaatttcacgcct
actttcccagaggctggtgctaccattccttgccttctgtctggcaagaaacagtcagag
gatgacctagacgagaaaccttttaaagagcctcttggtgcttcccttactatcagcatg
aacagcgttccttctcctattccctttgccagccccacacaagcagatttccgcacagac
atggggttgccacctaacgagccaatacccatcgcagccctaccatgcatacctggagat
ggaagaatgcccatcgaggagtgtaaggcagaagtaaaatctgttttgctctcaccagaa
gcgcctgttggtgcatctattcttcctcctccaccaccacattctgttcttcccaaaagg
aggccgggtcggccaaggcggtccccaccttctgtcctgtcattggatatgtactcgggc
aaaaccatcgagccacctcctgtccccgtggccttggtggaaagtgctatgagtaaagag
ctattgagtgcacatcctgatgctttctatggactgaaggaccctgaagccgtcacccta
gatttcaggaatgacagcttccatgagaaaatagcagctgagacagttgcagagaaactg
ccatttaaggaattggagaaccaatggaatgaagatttcaaggaagaagaagctcatgcg
aagcctaaaagacagtggcgaaggcagaagaagtcacctgagcacctcccagtgattcct
tccccagagtactccccaccccagcctcagttcaggccacgctcggagtttgaggagatg
accattttgtatgatatttggaatggaggcatagatgaggaagatatcaaattcatgtgt
atcacgtatgaccgcctcctgcagcaggacaatggtatggactggctcaatgacacgctg
tgggtattccatccttctaccagcttttccacccccaagaaaaagaagcgagacgatggg
atgcgggagcacgtcacaggctgtgcacgaagtgaaggctattacaaaattgataagaag
gacaaactcaaatacctcaacaatagccgagcttttgcagaggagcctccagctgacaca
caggggatgagcatccctgcccaacctcacgcttccacacgggctggctccgagcggcgg
tcagagcaacgcaggctcctctcctccttcactggtagctgcgacagtgacctgctcaag
ttcaaccagctcaagttccggaagaaaaagctaaaattctgcaagagccacattcatgac
tggggcctttttgccatggagcccattgcagctgatgagatggtgattgagtatgtgggt
cagaacatcaggcaggtcattgctgacatgcgtgaaaagcgatacgaggatgaaggcatt
gggagcagttacatgttcagagttgaccacgacacaatcatcgatgctacaaagtgtgga
aactttgccaggtttattaatcacagctgcaatccaaattgttacgctaaagtgatcacg
gtggagtctcaaaagaagattgtcatctactcaaaacagcacatcaatgtgaatgaggaa
attacttatgactacaagtttcccattgaggatgtaaaaatcccatgtctttgtggctct
gagaactgcaggggaaccctaaactga

DBGET integrated database retrieval system