KEGG   Gallus gallus (chicken): 416872Help
Entry
416872            CDS       T01006                                 

Gene name
PPP1CC
Definition
protein phosphatase 1, catalytic subunit, gamma isozyme (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
gga  Gallus gallus (chicken)
Pathway
mRNA surveillance pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Insulin signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    416872 (PPP1CC)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    416872 (PPP1CC)
  Cell growth and death
   04114 Oocyte meiosis
    416872 (PPP1CC)
  Cellular commiunity
   04510 Focal adhesion
    416872 (PPP1CC)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    416872 (PPP1CC)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    416872 (PPP1CC)
   04270 Vascular smooth muscle contraction
    416872 (PPP1CC)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    416872 (PPP1CC)
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     416872 (PPP1CC)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     416872 (PPP1CC)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     416872 (PPP1CC)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     416872 (PPP1CC)
Spliceosome [BR:gga03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    416872 (PPP1CC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
15
AA seq 323 aa AA seqDB search
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNASRPVTPPRSMITKQAKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggatatagacaagctgaacatcgacagcatcatccaacggctgctggaggtgaga
ggatcaaaaccaggtaaaaatgtccaacttcaagagaatgaaatcagaggactgtgcttg
aaatccagagaaatctttctcagtcagcctattctgctagaacttgaagctccactgaaa
atatgtggtgacatccatggacaatactatgacttgcttcggctctttgaatatggaggc
tttccaccagaaagcaactacctattccttggtgactatgttgacagaggaaagcagtct
ttagaaacaatttgtcttctactggcctacaaaattaaatatccggagaactttttcctc
ctcagagggaaccatgaatgtgccagcattaatagaatttatggattttatgacgaatgt
aagagaagatacaacattaagctgtggaagacattcacagattgttttaactgtttacca
attgcagcaattgtggatgagaagatattctgctgtcacggaggtttgtcaccagacctt
cagtcaatggaacagatcagacgaattatgcgccccactgatgtacctgaccagggtctc
ctttgtgatctcctgtggtctgaccctgacaaagatgtcttaggatggggtgaaaatgac
agaggagtgtcctttacttttggtgctgaagtggttgctaagtttctccataaacatgat
ttggatctcatatgtagagctcatcaggttgtggaagacggatatgagttttttgcaaaa
agacaattggtaactctcttttctgccccaaattactgtggagaatttgataatgcaggt
gccatgatgagtgtggatgaaaccttaatgtgttcttttcagattttgaaacccgcagag
aagaagaagcccaatgctagcagacctgtaacacctcccaggagtatgatcacaaagcaa
gcgaagaaatag

DBGET integrated database retrieval system