KEGG   Gallus gallus (chicken): 416896Help
Entry
416896            CDS       T01006                                 

Gene name
USP30
Definition
ubiquitin specific peptidase 30
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     416896 (USP30)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   416896 (USP30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
15
AA seq 502 aa AA seqDB search
MLPGGAVRRALRAGAGGRYRAMRSWGVIGGLAAAVAAGIYVLWGPIAERKKRRRGLVPGL
LNLGNTCFMNSLLQGLSSCPSFIRWLEEFTAQYKAEQEQPSEQQCLSLTLLHLLRALSCQ
EVTEDDVLDASCLLEVLRIYRWQISTFEEQDAHELFHVLTSSLEDERDRQPRVTHLFDVH
SLEQPEITQKQISCRTRGSLPPMSNHWKSQHPFHGRLTSNMVCKHCEHQSPVRYDTFDSL
SLSIPAAMWGHPMTLDHCLHHFISSESVKDVVCDNCTKIQAEGTLNGQSVENQKTTFVKQ
LKLGKLPQCLCIHLQRLSWSNQGTPLKRHEHVQFNEFLIMDIYKYHIPVHKSTQSDLNQK
SSEETKPGTKDGLAVKPSDAEQTCGTKSLLMNGACSSSFLMSSGTFPLTAFPECSSPVYL
YRLMAVVVHHGDMHSGHFVTYRRSPPSSKNPLSVSNQWLWISDDTVRKASLQEVLSSSAY
LLFYERVHSRVQHQSLELRPEE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccggcggcgccgtgcggcgggcgctgagggccggggcgggcggcaggtacagg
gcgatgcggagctggggggtgatcggggggctggcggccgccgtggcggcggggatctac
gtgctgtgggggcccatcgccgagaggaagaagcggaggagaggcctggtgcctggcctg
ctgaacctcggaaacacctgcttcatgaactccctgctgcaaggcctgtcctcgtgccca
tcgttcatcaggtggctggaggagttcacagcacagtacaaggcagaacaggaacaaccc
agcgagcagcagtgcttgtcgctcactctgctgcatctcctaagagctttatcctgtcaa
gaggtaacagaagatgatgtcctggatgcaagctgcttattagaagtgttaagaatttac
aggtggcagatctcgacatttgaagagcaggatgctcatgaactatttcatgtccttacc
tcttcattggaagatgaacgggatcgtcagccacgtgtcacacatctgtttgatgtgcat
tcgctggagcagccagaaataacccaaaagcaaataagctgccgaacaagaggatctctt
cctcctatgtcaaatcactggaagtctcagcatccttttcatggaaggctgactagcaac
atggtttgcaagcactgtgaacaccagagtcctgtgaggtacgatacatttgacagtctc
tcactgagcattccagcagctatgtggggtcatcccatgacactggatcactgcctccac
cacttcatctcctctgagtctgtgaaggatgttgtgtgtgacaactgcactaaaattcag
gcagaagggactctgaatggacagagcgtagagaaccagaaaacaacatttgttaagcaa
ttaaagctagggaagctccctcagtgtttgtgtatccatctgcaaagactgagctggtca
aaccaagggactcctctgaaacgtcatgaacacgtacagttcaatgagttcctaatcatg
gacatctacaaatatcacattcctgttcataaatcaactcagagtgatctgaatcagaaa
agctccgaagagacaaagcctggaacaaaggatgggctagcagtaaaaccttcagatgca
gaacagacatgtggtaccaaatcgctccttatgaatggggcatgttcctcttcatttcta
atgtcctcgggaacttttccgctcactgcattccctgaatgcagttcccccgtgtacctt
taccggctgatggcagtggttgtgcaccatggagacatgcattctggacactttgtgact
taccgccgctctccaccttcttcgaagaacccgctctctgtcagcaatcagtggttgtgg
atttcagatgatacggttcgcaaagctagtttgcaggaggtcctttcctctagtgcttat
ctgctgttctatgagcgcgttcactcaagggtacagcaccagagtttggagttgaggcct
gaagagtga

DBGET integrated database retrieval system