KEGG   Gallus gallus (chicken): 417143Help
Entry
417143            CDS       T01006                                 

Gene name
RXRA
Definition
retinoid X receptor, alpha
Orthology
K08524  
retinoid X receptor alpha
Organism
gga  Gallus gallus (chicken)
Pathway
PPAR signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    417143 (RXRA)
   03320 PPAR signaling pathway
    417143 (RXRA)
Transcription factors [BR:gga03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    417143 (RXRA)
Nuclear receptors [BR:gga03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   417143 (RXRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
17
AA seq 467 aa AA seqDB search
MDTKHFLPLDFSNQVNSTSLNSPTSRGPMATPSLHPSIGPGIGSSLGSPGQLHSPISTLS
SPINGMGPPFSVISSPMGPHSMSVPSTPSLGFGTSSPQLNSPMNPVSSSEDIKPPLGLNG
VLKVPAHPSGTMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNK
DCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKI
LEAELAVEPKTETYIEANMGLTPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLD
DQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVS
KMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPDQPGRF
AKLLLRLPALRSISLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaaacacttcctgccactggatttctcaaaccaagtcaattccacatccctg
aactccccgacgagccgaggccccatggccaccccatccctgcacccgtccatcgggccg
ggcatcggctcctcgctgggctccccgggccagctgcactcacccatcagcaccctgagc
tcacccatcaatggcatggggccacccttctccgtcatcagctcccccatgggcccacac
tcgatgtctgtcccctccacgcccagcctgggattcggcaccagcagcccacagctcaac
tcacccatgaaccccgtcagcagctcagaagacatcaagccacccctggggctcaatgga
gtcctcaaagtgccagcacatccctcaggaacaatggcctccttcaccaagcacatatgt
gccatctgcggggacagatcttcaggtaaacattatggggtgtacagctgcgagggctgc
aaaggcttcttcaaacgcacggtgaggaaggacctgacctacacctgccgtgacaacaag
gactgcttgatcgacaagcgccagcgcaaccgctgccagtactgccgctaccagaagtgt
cttgccatggggatgaagagggaagctgtgcaggaggagaggcagcgggggaaggaccgc
aacgagaacgaggtggagtccacaagtagcgccaacgaggacatgcccgtggagaagatc
ctggaagcagaactcgctgtggagccaaagacagagacgtacattgaggcaaacatgggc
ctgacgccgagctcgcccaacgacccggtgacgaacatttgccaggcggccgacaagcag
ctcttcaccttggtggagtgggccaagaggatcccccatttctcagagctgcccctggat
gaccaggtcatcctgctgcgagcagggtggaatgagctcctcatcgcctccttctcccac
cgctccatagctgtgaaggatgggatcctgctggccacggggctgcacgtgcaccgcaac
agcgcgcacagcgccggtgtcggggccatctttgacagagtactgacagaactcgtgtcg
aagatgcgagacatgcagatggacaagacagagctgggctgcctgcgagccatcgtcctc
ttcaaccccgactcaaaaggtctctccaacccggctgaagtggaggcattacgggagaag
gtgtacgcatcgctggaggcgtattgcaagcacaaataccccgaccagcccgggaggttc
gccaagctcctgctccgtctgccagccctacggtccatcagcctcaaatgcctggagcac
ctcttcttcttcaagctaataggcgacacgccgatcgacaccttcttgatggaaatgctg
gaagcaccccatcaaatgacttag

DBGET integrated database retrieval system