KEGG   Gallus gallus (chicken): 417175Help
Entry
417175            CDS       T01006                                 

Gene name
POMT1
Definition
protein-O-mannosyltransferase 1 (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
gga  Gallus gallus (chicken)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    417175 (POMT1)
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     417175 (POMT1)
Glycosyltransferases [BR:gga01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   417175 (POMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
17
AA seq 724 aa AA seqDB search
MLGFLKNPVVVTAEINLNLVVLTVMGLISRLWGLSYPRAVVFDEVYYGQFVSLYMKRIFF
VDDSGPPLGHMLLALGGYLGGFDGNFLWNRIGAEYSMNVPVWSLRFLPALAGALCIPLAY
QILVELQFSHCAALGAALLILLENSLITQSRFMLLESILIFFILLAVLSYLKFYNLQRHS
SFSGGWWFWLLLTGVACSCAVGVKYMGLFTYMLLLAIAGLHFWHMLGDRNLSNVSLVCHF
LARGLTLLVIPGPMYLSFFFVHLTLLYRSGPHDQIMTSAFQASLEGGLARITQGQPLEVA
YGSQITLRNVLGKPMQCWLHSHTNTYPIRYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
MQQLVVSNPPRPVRHGHIVQLVHGITTRYLNTHDVAAPLSPHSQEVSCYIDYNISMPAQN
LWRVEIVNRESDTDVWKTILSEVRFVHVNTSAVLKLSGASLPEWGYRQLEVVGEKLSKGY
HQSMVWNVEEHRYGKSQEQKEREVELHSPTRMDIGKNLSFMAKFTELQWKILTLKNEDTE
HKYSSSALDWITMDTNIAYWLHPTSGAQIHLLGNVCTWASANIAAVVYTCLSLWYLIRRR
RKIYDIPEDAWQLWVSAGQICVGGWVVNYLPFFLMEKTLFLYHYLPALTFQILLIPIVLQ
HLSDHLCRSLLSKSMFNALIVAWFSSVCFAYRTFSPVTYGEPLSVAELKDLRWKDSWNIL
IRKQ
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgttgggatttctgaagaacccagttgtggttactgcagagataaatctcaaccttgtg
gtgctgactgtcatgggattaataagccgtctatgggggctttcctatccacgtgctgtt
gtttttgatgaagtttattacggccaatttgtttccctctacatgaagagaatcttcttt
gtggatgacagcggcccaccgcttggccatatgctgctggctttgggaggttacttagga
ggatttgatggaaacttcttatggaacaggattggagctgaatacagcatgaacgttcct
gtgtggtccttgcggttcctgccagcactggctggtgctctctgcatccccttagcatac
cagattttggtagagctgcagttctcccactgtgctgcgcttggagctgctcttctgatt
ctcttagagaactctctgatcactcagtcaaggttcatgcttctggaatccatattgatt
ttttttatcctgcttgcagttttgtcctacttgaagttctacaatttgcagaggcacagt
tccttctccggagggtggtggttttggcttctgttgactggagtagcttgttcttgtgct
gttggagtgaaatacatgggcctgtttacctatatgctgctcctggccattgcaggactc
cacttctggcacatgttaggagaccggaacttgtcaaatgtttccttggtgtgccatttt
ctggctaggggactgaccctcctcgtcatcccagggcctatgtacctgtccttcttcttt
gtgcacttgactttgctgtatcgctctgggcctcatgaccagattatgacaagtgctttc
caagccagcttagagggtgggctggctcgaatcactcagggccagcccttagaggtggcc
tatggctctcagattactctgcggaacgtgctgggcaagcccatgcagtgttggctccat
tctcacacgaatacttaccccatcaggtatgagaatggccgagggagttcccatcagcaa
caggtgacctgttatccctttaaggatgtgaacaactggtggattgtcaaagatcctgga
atgcagcagctggtggtgagtaacccaccccgtcctgtcaggcatgggcacattgtgcag
ctggtccacggcatcacaactcggtacctcaacacgcatgatgttgctgcccctctcagc
ccccactcccaagaagtttcctgctatattgattataacatttccatgccagcacagaac
ctctggagagtggaaatcgtcaatcgggagtctgacacggatgtgtggaagaccattctg
tcagaagtgaggtttgttcacgtgaacacctctgcagtgctaaagctcagtggagcatct
ttacctgagtggggataccggcagctggaggtggttggagagaagctgtccaaaggctac
caccagagcatggtgtggaatgtggaagagcacagatatgggaaaagccaagagcaaaaa
gagagggaagtggaactccactctcccacacggatggatataggtaaaaacctaagcttc
atggcaaagttcacagaattgcagtggaagatactcacattgaaaaatgaagacacagaa
cataagtacagctcctctgctcttgactggatcacaatggacacgaatattgcatactgg
ctacatccaacctctggtgctcagatccatctccttgggaatgtttgcacctgggcttca
gctaacatcgctgctgtggtctacacgtgtctgtccctgtggtacttgatacgacgaaga
agaaaaatctatgatattcctgaagatgcatggcagctgtgggtatcagctgggcagatc
tgtgttggaggctgggttgtgaattacctgcccttcttcctgatggagaagacactgttc
ctgtaccactacttgcctgccctcacattccagattctcctgattcccatcgtattacag
catctcagcgatcatctctgcagatctctgctttccaagagcatgttcaatgcactgatc
gtagcctggttctcctccgtgtgctttgcctatcgcacgttcagccctgtgacctatggg
gagcccctttctgttgctgagctgaaggacctgcgctggaaggacagctggaacatcctc
atccgaaaacagtga

DBGET integrated database retrieval system