KEGG   Gallus gallus (chicken): 417180Help
Entry
417180            CDS       T01006                                 

Gene name
LAMC3
Definition
laminin, gamma 3
Orthology
K06247  
laminin, gamma 3
Organism
gga  Gallus gallus (chicken)
Pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    417180 (LAMC3)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    417180 (LAMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
17
AA seq 1574 aa AA seqDB search
MARLRALALLGVVLATAGSSPCYDPRGQPRRCMPVFENAAFGRVPLVSNTCGSPPEDYCL
QMGARDASQLCQRCDAADPLLHHNASFLTDFHSQEESTWWQSQSMAFGIQHPNSVNITLH
LGKSYEITYVRLKFHTSRPESFAIYKRSRADGPWVPFQFYSASCEKTYRKRQRQYLQPGE
NEQVAFCTDEFSDISPLSGGNVAFSTLEGRPSAYNFDGSPTLQEWVTVTDLLISLNRLNT
FGDDIFKDPKVLQSYYYAISDFSVGGRCKCNGHASECAPDEAGRLVCVCEHNTAGTDCQH
CQPFYQDRPWARGTAEAANECLPCDCSGRSEECFYDAELFRRTGRGGHCRNCRDNTAGPR
CEQCRQNHYRWEQQAACQPCHCHPAGSLRPQCDSSGTCTCKANVTGWKCERCKDGYHSLS
EGGCRPCTCDPAGSVGTCDPNTGHCTCKERVEGHLCNRCQPGWFNLQPYNPIGCTSCFCY
GHSAVCMAADGYEVTHIRSDFREGLEGWAAAAGDVEVPLHWADGEIGTEWDKEEPLDLRA
PEKFLQNQRLIYGQPLSLLLGAEGNGTRAESGVFLLGVQLVLEGEGLQVTMSSSESQAQD
GKQAVTFRLHEAEEGTEPLLSAFSFQRLLSNLTALRLRVSRGPGPGRLWLSRVQLTSARR
GAGMRAGWVEECTCPPSYAGSFCESCAPGFKRDIPFGGPFVTCVPCTCNQHGDCEPLSGH
CRCLHNTEGPSCERCSPGFYGNPFTGHPDDCKPCPCPGRSPCTQLPSSGEVVCTHCPPGQ
RGKRCELCDDGFFGDPLGQRGPVRPCIPCQCHGNVDLNAVGNCDSVSGRCLRCLHNTTGE
QCQQCRPGFYGDALAPSPAGKCASCNCNPDGSALGLEGCDPGTGQCLCLPHVLGRTCGLC
QHGYYGLQAAVGCKSCECHPVGSQDSGCHAVTGQCSCQPGVTGLRCDRCEHGFFGFSARG
CRACNCSPLGSASAQCHENSTCLCRPGFVGYKCDRCQANFFPDPPSSSCQPCPTCYGLVK
DGVERLRVKLQEVEEWLQAPGCELRLGQPPVMGDESRGDGLSTQHLLQGAHAVLSTQVGR
LSGMLSTARGHLSNAIGASGCSSRGPPKTCTLLSEIRAVLQSAQQEILHAADTLAATEIP
QEIPLLPTNWSRWATEARVLAERHGDTAAQVEAAVRRALGASNTSHELLRTLLEGRVAQE
AQWELEAGYEEIQQAWKELGAGMEEVAVEARRTLTAIQEANVGMAKKLQQVPAPGQVLLV
QAEALAQEVAALEQTVQAQEPAAWQSITASLSMAAGLRRDLQGTRSFVQLQDRAGSAHDL
STSAVSQGKAVLSGAESLLGSLEGMRKVLGHRKGRAALRRRMAQVRDRAMVEAQKKIKQA
EKMLGNSLSVSSAARRKAGEAVHVAGESSKRAQAVLQGSKQARKHTRTLATRVSETQQEL
YRQQRVAEELRGSLEEAEQVGTEVSEMAKSLREARGSLMADIETLNDLLHSLGGLEPGMQ
AEAVLGAGRLQLERLRRRLNAPGALATQLGQLQQEAELQQDRIRVFENDLVEIRADKQNL
EDILRSLPEGCSKW
NT seq 4725 nt NT seq  +upstreamnt  +downstreamnt
atggcccggctcagggcgctggccctgctgggggtagtgctggctactgcgggctcgtcc
ccctgctacgacccccgggggcagccccgccgctgcatgcccgtcttcgagaacgccgct
ttcggccgcgtcccgctggtcagcaacacgtgcggctctccgcccgaggattactgcctg
cagatgggcgcgcgcgatgccagccagctgtgccagcgctgcgacgccgccgacccgctg
ctgcaccacaacgcctctttcctcaccgacttccacagccaggaggagagcacctggtgg
cagagccagtccatggccttcggcatccagcatcccaactctgtcaacatcacgctccac
ctgggaaagtcctatgagatcacctacgtgcgcctgaagttccacaccagccgtcccgag
agcttcgccatttacaagcgcagccgtgccgacggcccctgggtgcccttccagttctac
agcgcgtcctgtgagaagacctacaggaagcggcagaggcagtacctgcagccgggtgag
aacgagcaggtggccttctgcaccgacgagttcagcgacatctccccactgagtggtggc
aacgtggctttctccacccttgagggccgtcccagtgcctacaattttgatgggagtccc
acactacaggagtgggtgaccgtcaccgacctgctcatctccctgaaccgcctcaatacc
ttcggggatgacatcttcaaggaccccaaggtgctgcagtcgtactactacgccatctcc
gacttctctgttggcggcaggtgtaaatgcaacggtcacgccagcgagtgcgcgccggac
gaggcaggacggctggtgtgcgtgtgtgagcacaacacggctggcaccgactgccagcac
tgccagcccttctaccaggaccggccctgggcgcgcggcacggctgaggctgccaatgag
tgcctcccttgcgactgcagcggccgctcggaggaatgcttctacgacgcggagctgttc
cgccgcaccgggcgtggggggcactgccggaactgccgcgacaacacggccgggccacgc
tgcgagcagtgccggcagaaccactaccgctgggagcagcaggccgcctgccagccctgc
cactgccaccccgcaggttccctgcggccccagtgtgacagctcggggacctgcacctgc
aaagccaatgtgacaggctggaagtgcgaacgctgcaaggacggctatcacagcctgagt
gagggtggctgcagaccctgcacctgtgaccctgcgggcagcgtgggcacctgtgacccc
aacactgggcattgcacctgcaaggagagggtggaggggcacctgtgcaacagatgccag
cccggttggttcaacctacagccctacaaccccattggttgcaccagctgtttttgctat
ggccactccgccgtctgcatggcagcagatggctatgaggtgacccacatccgctctgac
ttcagggaagggctggaaggctgggctgcagctgcgggggatgtggaggtgcctctgcac
tgggctgatggggagattggcactgagtgggacaaagaggagccgctggacctccgtgca
ccggagaagtttctgcagaaccagcgtctgatctacgggcagcccctgtccctgctgctg
ggagcggaggggaacggaaccagggcagagagtggggtgtttctgcttggggtgcagctg
gtgctggagggtgaggggctgcaggtcaccatgtccagcagtgagagccaagcacaggac
gggaagcaggctgtcaccttcaggctgcatgaggcagaggagggcacggagcctttgctg
tcagccttcagcttccagcgcctgctttccaacctcaccgcccttcgcctccgcgtgagc
cgtggccctgggccaggcaggctgtggctgagccgggtgcagctcacgtcagctcgccgc
ggtgcaggcatgcgggcaggatgggtggaggagtgcacatgtcctcccagctacgctggg
tccttctgtgaatcctgtgcacctggcttcaagcgggacatcccctttggtggccccttt
gtcacctgcgtgccctgcacctgcaaccagcatggggactgcgagccgctctcagggcac
tgccgctgcttgcacaacacggagggtccctcctgcgagcgttgcagccccgggttttat
ggcaaccccttcactgggcaccccgatgactgcaagccttgcccgtgccctggccgctca
ccctgcactcagctgcccagcagtggggaggtggtgtgcacccactgccccccggggcag
agagggaagcgctgcgagctgtgcgatgatggatttttcggggaccccttggggcagagg
ggtcccgtgcgtccctgcatcccctgccagtgtcatgggaatgtggacctcaatgctgta
gggaactgtgactccgtgtccggacgctgcctgcgctgcctgcacaacacaacgggagag
cagtgccaacagtgtcggccggggttctacggggatgcgttggcccccagccctgctggg
aagtgtgcgtcgtgcaactgcaaccctgatggctcagctctggggctggagggctgcgat
ccgggcacggggcagtgcctctgcctcccacacgtgttgggcagaacgtgtgggctgtgc
cagcacggctactatgggctgcaggctgccgtgggctgcaagagctgtgagtgccaccca
gtggggtcccaggacagtgggtgccatgcagtgacggggcagtgctcctgccagccaggt
gtcacagggctgcggtgtgacagatgcgagcacggcttcttcggcttctcagccaggggc
tgccgagcatgcaactgctccccgctgggctccgccagtgcgcagtgccacgagaacagc
acctgtctctgccgccccggcttcgtgggctataagtgcgaccgctgccaggccaacttc
ttccctgacccaccgagctccagctgccagccgtgtcccacatgctatgggctggtgaag
gatggggtggagcggctcagggtgaagctgcaggaggtggaggaatggctgcaagcaccg
ggctgtgagctccgcctggggcagccccctgtgatgggagatgaaagccggggagatggg
ctgagcacacagcatctcctgcaaggtgcccatgccgtgctctcgacacaggtgggacgg
ctgtcagggatgctgagcactgcacggggccatctcagcaatgccatcggggcaagtggc
tgctccagccgtggaccccccaagacctgcacgctgctgtcagagatcagggccgtgctg
cagtcagcacagcaggagatcctgcacgctgctgacactctggctgccacggagattccc
caggagatccccctgctgcccaccaactggagccgctgggcaacggaggcgcgggtgctg
gcagagaggcatggggatactgcagcacaggtggaggcagcagtgaggagagcactgggt
gcctccaacaccagccatgagctcctgaggacgctgctggaggggagagtggcacaggag
gcacagtgggagctggaggccgggtatgaagaaatccagcaggcgtggaaggagctgggt
gctggcatggaagaggtggcagtggaagccaggagaactctcacagccatccaggaggca
aatgtgggcatggccaagaagcttcagcaggtgcctgctccagggcaggtgctgctggtg
caagctgaggccctagcacaggaggtggcagcactggagcagacagtgcaggcgcaggag
ccagcagcttggcagagcatcacagcgtccctcagcatggcagctgggctgcgtcgggac
ctgcagggcactcgaagctttgtacagctccaggaccgggctggctctgctcatgatcta
tccacctcagcagtctcgcaggggaaagcagtgctctccggtgcagagtccctcctgggc
agcttggaaggcatgaggaaggtgttggggcatcggaaaggtcgtgctgccctgagaagg
agaatggcacaagtgcgggacagagcaatggtggaggcccagaagaagattaaacaggca
gagaaaatgctgggaaactccttgtctgtctccagtgcggccaggaggaaggcaggggag
gctgtgcatgttgctggggagagcagtaagagggcccaggctgtactgcagggcagcaag
caggctcgcaagcacaccaggacgctcgccacacgtgtcagcgagacccagcaggagctg
taccggcagcagcgcgtggctgaggagctcagggggagcctggaggaggcagagcaggtg
gggaccgaggtgagcgagatggcaaaaagcctgcgggaagcccggggctcactgatggca
gacatcgagaccctgaatgatctgctgcacagcctgggcggcctggagccgggcatgcag
gcggaggcagtgctgggtgccgggcggctgcagctggagcggctgcggcggcggctcaat
gctccaggagccctggccacgcagctcgggcagctgcagcaggaggcagagctgcagcag
gataggatccgggtgtttgagaacgacttggtggagatccgggccgacaagcagaacctg
gaggacattttgcggagcctccccgagggctgctccaagtggtag

DBGET integrated database retrieval system