KEGG   Gallus gallus (chicken): 417180Help
Entry
417180            CDS       T01006                                 

Gene name
LAMC3
Definition
(RefSeq) laminin, gamma 3
  KO
K06247  
laminin, gamma 3
Organism
gga  Gallus gallus (chicken)
Pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    417180 (LAMC3)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    417180 (LAMC3)
Cell adhesion molecules and their ligands [BR:gga04516]
 1. Immunoglobulin Superfamily
  Others
   LU; Lutheran blood group glycoprotein [KO:K06578]
    Laminin-14 Extracellular matrix (ECM) components
     417180 (LAMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
17
AA seq 1662 aa AA seqDB search
MHQLGGIAACSAPPVGLSVALGGAPAPLPAPRTERLTFPAASSRWTSEREEVPGWGPVPS
HPIPSYPNPSHRAVPAGGGSVRSEPNPAMARLRALALLGVVLATAGSSPCYDRRGQPRRC
MPVFENAAFGRVPLVSNTCGSPPEDYCLQMGARDASQLCQRCDAADPLLHHNASFLTDFH
SQEESTWWQSQSMAFGIQHPNSVNITLHLGKSYEITYVRLKFHTSRPESFAIYKRSRADG
PWVPFQFYSASCEKTYRKRQRQYLQPGENEQVAFCTDEFSDISPLSGGNVAFSTLEGRPS
AYNFDGSPTLQEWVTVTDLLISLNRLNTFGDDIFKDPKVLQSYYYAISDFSVGGRCKCNG
HASECAPDEAGRLVCVCEHNTAGTDCQHCQPFYQDRPWARGTAEAANECLPCDCSGRSEE
CFYDAELFRRTGRGGHCRNCRDNTAGPRCEQCRQNHYRWEQQAACQPCHCHPAGSLRPQC
DSSGTCTCKANVTGWKCERCKDGYHSLSEGGCRPCTCDPAGSVGTCDPNTGHCTCKERVE
GHLCNRCQPGWFNLQPYNPIGCTSCFCYGHSAVCMAADGYEVTHIRSDFREGLEGWAAAA
GDVEVPLHWADGEIGTEWDKEEPLDLRAPEKFLQNQRLSYGQPLSLLLGAEGNGTRAESG
VFLLGVQLVLEGEGLQVTMSSSESQAQDGKQAVTFRLHEAEEGTEPLLSAFSFQRLLSNL
TALRLRVSRGPGPGRLWLSRVQLTSARRGAGMRAGWVEECTCPPSYTGSFCESCAPGFKR
DIPFGGPFVTCVPCTCNQHGDCEPLSGHCRCLHNTEGPSCERCSPGFYGNPFTGHPDDCK
PCPCPGRSPCTQLPSSGEVVCTHCPPGQRGKRCELCDDGFFGDPLGQRGPVRPCIPCQCH
GNVDLNAVGNCDSVSGRCLRCLHNTTGEQCQQCRPGFYGDALAPSPAGKCAPCNCNPDGS
ALGLEGCDPGTGQCLCLPHVLGRTCGLCQHGYYGLQAAVGCKSCECHPVGSQDSGCHAVT
GQCSCQPGVTGLRCDRCEHGFFGFSARGCRACNCSPLGSASAQCHENSTCLCRPGFVGYK
CDRCQANFFPDPPSSSCQPCPTCYGLVKDGVERLRVKLQEVEEWLQAPGCELRLGQPPVM
GDESRGDGLSTQHLLQGAHAVLSTQVGRLSGMLSTARGHLSNAIGASGCSSRGPPKTCTL
LSEIRAVLQSAQQEILHAADTLAATEIPQEIPLLPTNWSRWATEARVLAERHGDTAAQVE
AAVRRALGASNTSHELLRTLLEGRVAQEAQWELEAGYEEIQQAWKELGAGMEEVAVEARR
TLTAIQEANVGMAKKLQQVPAPGQVLLVQAEALAQEVAALEQTVQAQEPAAWQSITASLS
MAAGLRRDLQGTRSFVQLQDRAGSAHDLSTSAVSQGKSVLSGAESLLGSLEGMRKVLGHR
KGRTALRRRMAQVRDRAMVEAQKKIKQAEKMLGNSLSVSSAARRKAGEAVHVAGESSKRA
QAVLQGSKQARKHTRTLATRVSETQQELYRQQRVAEELRGSLEEAEQVGTEVSEMAKSLR
EARGSLMADIETLNDLLHSLGGLEPGVQAEAVLGAGRLQLERLRRRLNAPGALATQLGQL
QQEAELQQDRIRVFENDLVEIRADKQNLEDILRSLPEGCSKW
NT seq 4989 nt NT seq  +upstreamnt  +downstreamnt
atgcaccagctgggggggattgcagcctgctcagccccacctgtggggctcagcgtggcc
ttggggggagctccagccccgctgccggcaccacgcacggagcgtttgacgttcccagca
gcatccagcagatggacctcggagcgagaggaggtgccgggctgggggcctgtcccatcc
catcccatcccatcgtatcccaacccatcccatcgcgccgtgccagccggaggaggctca
gtgcgcagcgagccgaaccccgccatggcccggctcagggcgctggccctgctgggggta
gtgctggctactgcgggctcgtccccctgctacgaccgccgggggcagccccgccgctgc
atgcccgtcttcgagaacgccgctttcggccgcgtcccgctggtcagcaacacgtgcggc
tctccgcccgaggattactgcctgcagatgggcgcgcgcgatgccagccagctgtgccag
cgctgcgacgccgccgacccgctgctgcaccacaacgcctctttcctcaccgacttccac
agccaggaggagagcacctggtggcagagccagtccatggccttcggcatccagcatccc
aactctgtcaacatcacgctccacctgggaaagtcctatgagatcacctacgtgcgcctg
aagttccacaccagccgtcccgagagcttcgccatttacaagcgcagccgtgccgacggc
ccctgggtgcccttccagttctacagcgcgtcctgtgagaagacctacaggaagcggcag
aggcagtacctgcagccgggtgagaacgagcaggtggccttctgcaccgacgagttcagc
gacatctccccactgagtggtggcaacgtggctttctccacccttgagggccgtcccagt
gcctacaattttgatgggagtcccacactacaggagtgggtgaccgtcaccgacctgctc
atctccctgaaccgcctcaatacctttggggatgacatcttcaaggaccccaaggtgctg
cagtcgtactactacgccatctccgacttctctgttggcggcaggtgtaaatgcaacggt
cacgccagcgagtgcgcgccggacgaggcaggacggctggtgtgcgtgtgtgagcacaac
acggctggcaccgactgccagcactgccagcccttctaccaggaccggccctgggcgcgc
ggcacggctgaggctgccaatgagtgcctcccttgcgactgcagcggccgctcggaggaa
tgcttctacgacgcggagctgttccgccgcaccgggcgtggggggcactgccggaactgc
cgcgacaacacggccgggccacgctgcgagcagtgccggcagaaccactaccgctgggag
cagcaggccgcctgccagccctgccactgccaccccgcaggttccctgcggccccagtgt
gacagctcggggacctgcacctgcaaagccaatgtgacaggctggaagtgcgaacgctgc
aaggacggctatcacagcctgagtgagggtggctgcagaccctgcacctgtgaccctgcg
ggcagcgtgggcacctgtgaccccaacactgggcattgcacctgcaaggagagggtggag
gggcacctgtgcaacagatgccagcccggttggttcaacctacagccctacaaccccatt
ggttgcaccagctgtttttgctatggccactccgccgtctgcatggcagcagatggctat
gaggtgacccacatccgctctgacttcagggaagggctggaaggctgggctgcagctgcg
ggggatgtggaggtgcctctgcactgggctgatggggagattggcactgagtgggacaaa
gaggagccgctggacctccgtgcaccggagaagtttctgcagaaccagcgtctgagctac
gggcagcccctgtccctgctgctgggagcggaggggaacggaaccagggcagagagtggg
gtgtttctgcttggggtgcagctggtgctggagggtgaggggctgcaggtcaccatgtcc
agcagcgagagccaagcacaggacgggaagcaggctgtcaccttcaggctgcatgaggca
gaggagggcacggagcctttgctgtcagccttcagcttccagcgcctgctctccaacctc
accgcccttcgcctccgcgtgagccgtggccctgggccaggcaggctgtggctgagccgg
gtgcagctcacgtcggctcgccgcggtgcaggcatgcgggcaggatgggtggaggagtgc
acatgtcctcccagctacactgggtccttctgtgaatcctgtgcacctggcttcaagcgg
gacatcccctttggtggcccctttgtcacctgcgtgccctgcacctgcaaccagcatggg
gactgcgagccgctctcagggcactgccgctgcttgcacaacacggagggtccctcctgc
gagcgttgcagccccgggttttatggcaaccccttcactgggcaccccgatgactgcaag
ccttgcccatgccctggccgctcaccctgcactcagctgcccagcagtggggaggtggtg
tgcacccactgccccccggggcagagagggaagcgctgcgagctgtgcgatgatggattt
ttcggggaccccttggggcagaggggtcccgtgcgtccctgcatcccctgccagtgtcat
gggaatgtggacctcaatgctgtagggaactgtgactccgtgtccggacgctgcctgcgc
tgcctgcacaacacaacgggagagcagtgccaacagtgtcggccggggttctacggggat
gcgttggcccccagccctgctgggaagtgtgcgccgtgcaactgcaaccctgatggctca
gctctggggctggagggctgcgatccgggcacggggcagtgcctctgcctcccacacgtg
ttgggcagaacgtgtgggctgtgccagcacggctactatgggctgcaggctgccgtgggc
tgcaagagctgtgagtgccacccagtggggtcccaggacagtgggtgccatgcagtgacg
gggcagtgctcctgccagccaggtgtcacagggctgcggtgtgacagatgcgagcacggc
ttcttcggcttctcagccaggggctgccgagcatgcaactgctccccgctgggctccgcc
agtgcgcagtgccacgagaacagcacctgtctctgccgccccggcttcgtgggctataag
tgcgaccgctgccaggccaacttcttccctgacccaccgagctccagctgccagccgtgt
cccacctgctatgggctggtgaaggatggggtggagcggctcagggtgaagctgcaggag
gtggaggaatggctgcaagcaccgggctgtgagctccgcctggggcagccccctgtgatg
ggagatgaaagccggggagatgggctgagcacacagcacctcctgcaaggtgcccatgcc
gtgctctcgacacaggtgggacggctgtcagggatgctgagcactgcacggggccatctc
agcaatgccatcggggcaagtggctgctccagccgtggaccccccaagacctgcacgctg
ctgtcagagatcagggccgtgctgcagtcagcacagcaggagatcctgcacgctgctgac
actctggctgccacggagattccccaggagatccccctgctgcccaccaactggagccgc
tgggcaacggaggcgcgggtgctggcagagaggcatggggatactgcagcacaggtggag
gcagcagtgaggagagcactgggtgcctccaacaccagccatgagctcctgaggacgctg
ctggaggggagagtggcacaggaggcacagtgggagctggaggccgggtatgaagaaatc
cagcaggcgtggaaggagctgggtgctggcatggaagaggtggcagtggaagccaggaga
actctcacagccatccaggaggcaaacgtgggcatggccaagaagcttcagcaggtgcct
gctccagggcaggtgctgctggtgcaagctgaggccctagcacaggaggtggcagcactg
gagcagacagtgcaggcgcaggagccagcagcttggcagagcatcacagcgtccctcagc
atggcagctgggctgcgtcgggacctgcagggcactcgaagctttgtacagctccaggac
cgggctggctctgctcatgatctatccacctcagcagtctcgcaggggaaatcagtgctc
tccggtgcagagtccctcctgggcagcttggaaggcatgaggaaggtgttggggcatcgg
aaaggtcgtactgccctgagaaggagaatggcacaagtgcgggacagagcgatggtggag
gcccagaagaagattaaacaggcagagaaaatgctgggaaactccttgtctgtctccagt
gcggccaggaggaaggcaggggaggctgtgcatgttgctggggagagcagtaagagggcc
caggctgtactgcagggcagcaagcaggctcgcaagcacaccaggacgctcgccacacgt
gtcagcgagacccagcaggagctgtaccggcagcagcgcgtggctgaggagctcaggggg
agcctggaggaggcagagcaggtggggacggaggtgagcgagatggcaaaaagcctgcgg
gaagcccggggctcactgatggcagacatcgagaccctgaatgatctgctgcacagcctg
ggcggcctggagccgggcgtgcaggcggaggcggtgctgggtgccgggcggctgcagctg
gagcggctgcggcggcggctcaatgctccaggagccctggccacacagctcgggcagctg
cagcaggaggcagagctgcagcaggataggatccgggtgtttgagaacgacttggtggag
atccgggccgacaagcagaacctggaggacattttgcggagcctccccgagggctgctcc
aagtggtag

DBGET integrated database retrieval system