KEGG   Gallus gallus (chicken): 417287Help
Entry
417287            CDS       T01006                                 

Gene name
TRAF2
Definition
TNF receptor-associated factor 2
Orthology
K03173  
TNF receptor-associated factor 2
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
RIG-I-like receptor signaling pathway
Adipocytokine signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    417287 (TRAF2)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    417287 (TRAF2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    417287 (TRAF2)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    417287 (TRAF2)
  Endocrine system
   04920 Adipocytokine signaling pathway
    417287 (TRAF2)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    417287 (TRAF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
17
AA seq 552 aa AA seqDB search
MALCVQALRVQPEFFVPMAAANSTPPGSLDLSQPGFAKEILGTKLEVKYLCSDCRNILRR
PFQAQCGHRYCSYCLKKIISSGPQKCASCIQEGIYEEGISILETSSAFPDNAARREVESL
PAVCINEGCTWKGTIKEYESCHEGNCPFLLIECQACRGVIPLNEKERHSERECPERTLNC
KYCKSLFYFPDIKAHDEVCPKFPLTCDGCGKKKIPREKFQDHVKNCGKCKVPCRFKVVGC
AEMVENEKLPEHESKCLAEHLYMLLSFVLSLKSGSGDLKHLPAIPSSQSSSPLLAANSLC
PESELFKSLELLGRCDALEKKTVTFENIVCVLNREVERVSLTAEAYSRQHRLDQEQIETL
SNKVRQLERSIGLKDLAMAEMEEKIRNMEASTYDGVFIWKITEFARKRQEAITGRSPAIF
SPAFYTSKYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVGLGWSPQ
HCLQPSAAPGLKASRPAGRVWGTARAAGQRAGESRAVLLPRGQPTSACCAACSRCLHSIT
HSDFSFWALQNA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgtgtgtgcaggctctgcgcgtacagccggaattttttgttcccatggcagca
gcaaactcgactccgcccggctctctggacctgagccagcccgggtttgcgaaggagatc
ctgggaactaagctggaggtgaagtacctctgctcggactgcaggaacatattgaggcgg
cccttccaggcacagtgcgggcatcgctactgctcctattgcttgaagaaaatcataagt
tctggacctcagaagtgtgcgagctgcattcaggaaggaatatacgaagaaggaatttct
attttggaaacgagctctgctttcccagacaacgcagctcgtcgggaggtggaaagtctg
cccgctgtctgtattaatgagggctgcacgtggaaggggactattaaagaatatgagagc
tgccatgaggggaactgcccgttcctgctgattgagtgccaggcatgcagaggtgtgatc
cctctgaatgagaaggagcgccactctgagcgggagtgccctgagagaaccctcaactgc
aaatactgcaaatcacttttctacttccctgatattaaggctcacgacgaggtctgccca
aaatttccattgacttgtgatggctgcgggaagaagaagatccccagagagaagtttcag
gaccacgtgaagaactgcggcaaatgcaaagtgccttgcagattcaaggttgtcggctgt
gctgagatggtggaaaatgaaaagctaccagaacacgaaagcaagtgcctggcagagcat
ctatacatgctgctgagttttgtgctcagcctcaagagtggatctggagacctgaagcac
cttcctgccattccctcatcacagagcagctccccgctgctggcagcaaactccctgtgc
ccggagtcggagctcttcaaatccctggagctcttgggaaggtgtgacgccctggagaag
aaaacagtgacctttgagaacatcgtctgcgtgctcaatagagaggtagaaagggtatct
ctgacagctgaagcgtacagccggcagcatcgattagaccaggagcagatcgagacgctg
agtaacaaggttcggcagctggaaaggagcattgggctgaaagacctggccatggctgag
atggaggagaagatccgcaacatggaggcttccacctacgatggtgttttcatctggaag
ataacagaatttgccaggaagcgccaggaggcgatcacgggccgctctccggcgatcttc
tctccagctttctacacgagcaagtatggctacaagatgtgtctgcgcgtttacctgaac
ggggatggcaccgggcgtgggacccatctgtccctgttcttcgtggtgatgaaaggaccc
aacgatgcgctcctgcgttggcccttcaaccagaaggtgggtttgggttggagcccccag
cactgcctgcagccatcagctgctccggggctgaaagcgtcccgtcctgcaggcagggtg
tggggaacggcgagggctgcgggacagcgtgctggagagagcagagccgtgctgctgcca
cggggccaacccacctctgcgtgctgcgctgcctgcagtcggtgcttgcacagcatcacc
cattcagatttcagcttctgggctttgcaaaacgcgtaa

DBGET integrated database retrieval system