KEGG   Gallus gallus (chicken): 417287Help
Entry
417287            CDS       T01006                                 

Gene name
TRAF2, TRAF2S
Definition
(RefSeq) TNF receptor associated factor 2
  KO
K03173  
TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Adipocytokine signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    417287 (TRAF2)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    417287 (TRAF2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    417287 (TRAF2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    417287 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    417287 (TRAF2)
  Endocrine system
   04920 Adipocytokine signaling pathway
    417287 (TRAF2)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    417287 (TRAF2)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     417287 (TRAF2)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     417287 (TRAF2)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    417287 (TRAF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
17
AA seq 601 aa AA seqDB search
MTAGVTHSVGGGGGLHERSGGVWPCRVWPCRPALSRPSPRAGSLPGGGAVRGGPRSTCPA
GGACARFRCGARTDGAAANSTPPGSLDLSQPGFAKEILGTKLEVKYLCSDCRNILRRPFQ
AQCGHRYCSYCLKKIISSGPQKCASCIQEGIYEEGISILETSSAFPDNAARREVESLPAV
CINEGCTWKGTIKEYESCHEGNCPFLLIECQACRGVIPLNEKERHSERECPERTLNCKYC
KSLFYFPDIKAHDEVCPKFPLTCDGCGKKKIPREKFQDHVKNCGKCKVPCRFKVVGCAEM
VENEKLPEHESKCLAEHLYMLLSFVLSLKSGSGDLKHLPAIPSSQSSSPLLAANSLCPES
ELFKSLELLGRCDALEKKTVTFENIVCVLNREVERVSLTAEAYSRQHRLDQEQIETLSNK
VRQLERSIGLKDLAMAEMEEKIRNMEASTYDGVFIWKITEFARKRQEAITGRSPAIFSPA
FYTSKYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNR
EHIIDAFRPDVTSSSFQRPVTEMNIASGCPLFCPVSVMEAKNSYVRDDAIFIKAIVDLSG
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaggggtgacacacagcgtggggggtggggggggtctccatgagaggagcggc
ggggtgtggccgtgccgggtgtggccgtgccgccccgccctcagccgtccgtcgccacgg
gcgggatcgttgccgggcggtggcgcagtgcggggcgggccgcgctccacgtgtccggcg
ggcggggcctgcgcgcgtttccggtgcggagcgcggacggacggggccgcagcaaactcg
actccgcccggctctctggacctgagccagcccgggtttgcgaaggagatcctgggaact
aagctggaggtgaagtacctctgctcggactgcaggaacatattgaggcggcccttccag
gcacagtgcgggcatcgctactgctcctattgcttgaagaaaatcataagttctggacct
cagaagtgtgcgagctgcattcaggaaggaatatacgaagaaggaatttctattttggaa
acgagctctgctttcccagacaacgcagctcgtcgggaggtggaaagtctgcccgctgtc
tgtattaatgagggctgcacgtggaaggggactattaaagaatatgagagctgccatgag
gggaactgcccgttcctgctgattgagtgccaggcatgcagaggtgtgatccctctgaat
gagaaggagcgccactctgagcgggagtgccctgagagaaccctcaactgcaaatactgc
aaatcacttttctacttccctgatattaaggctcacgacgaggtctgcccaaaatttcca
ttgacttgtgatggctgcgggaagaagaagatccccagagagaagtttcaggaccacgtg
aagaactgcggcaaatgcaaagtgccttgcagattcaaggttgtcggctgtgctgagatg
gtggaaaatgaaaagctaccagaacacgaaagcaagtgcctggcagagcatctatacatg
ctgctgagttttgtgctcagcctcaagagtggatctggagacctgaagcaccttcctgcc
attccctcatcacagagcagctccccgctgctggcagcaaactccctgtgcccggagtcg
gagctcttcaaatccctggagctcttgggaaggtgtgacgccctggagaagaaaacagtg
acctttgagaacatcgtctgcgtgctcaatagagaggtagaaagggtatctctgacagct
gaagcgtacagccggcagcatcgattagaccaggagcagatcgagacgctgagtaacaag
gttcggcagctggaaaggagcattgggctgaaagacctggccatggctgagatggaggag
aagatccgcaacatggaggcttccacctacgatggtgttttcatctggaagataacagaa
tttgccaggaagcgccaggaggcgatcacgggccgctctccggcgatcttctctccagct
ttctacacgagcaagtatggctacaagatgtgtctgcgcgtttacctgaacggggatggc
accgggcgtgggacccatctgtccctgttcttcgtggtgatgaaaggacccaacgatgcg
ctcctgcgttggcccttcaaccagaaggtgaccctgatgctcttggatcagaacaaccgg
gagcacatcattgatgcgttccgacccgacgtgacctcctcctcctttcagcgcccggtc
acggaaatgaacattgccagcggctgcccgctgttctgccccgtctccgtgatggaagcc
aagaactcctacgtccgcgatgacgccatcttcattaaagccatcgttgacctctcgggc
ctttaa

DBGET integrated database retrieval system