KEGG   Gallus gallus (chicken): 417287Help
Entry
417287            CDS       T01006                                 

Gene name
TRAF2
Definition
TNF receptor-associated factor 2
Orthology
K03173  
TNF receptor-associated factor 2
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
RIG-I-like receptor signaling pathway
Adipocytokine signaling pathway
Herpes simplex infection
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:gga04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:gga04010]
Cellular Processes; Cell growth and death; Apoptosis [PATH:gga04210]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:gga04622]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:gga04920]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:gga05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
17
AA seq 552 aa AA seqDB search
MALCVQALRVQPEFFVPMAAANSTPPGSLDLSQPGFAKEILGTKLEVKYLCSDCRNILRR
PFQAQCGHRYCSYCLKKIISSGPQKCASCIQEGIYEEGISILETSSAFPDNAARREVESL
PAVCINEGCTWKGTIKEYESCHEGNCPFLLIECQACRGVIPLNEKERHSERECPERTLNC
KYCKSLFYFPDIKAHDEVCPKFPLTCDGCGKKKIPREKFQDHVKNCGKCKVPCRFKVVGC
AEMVENEKLPEHESKCLAEHLYMLLSFVLSLKSGSGDLKHLPAIPSSQSSSPLLAANSLC
PESELFKSLELLGRCDALEKKTVTFENIVCVLNREVERVSLTAEAYSRQHRLDQEQIETL
SNKVRQLERSIGLKDLAMAEMEEKIRNMEASTYDGVFIWKITEFARKRQEAITGRSPAIF
SPAFYTSKYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVGLGWSPQ
HCLQPSAAPGLKASRPAGRVWGTARAAGQRAGESRAVLLPRGQPTSACCAACSRCLHSIT
HSDFSFWALQNA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgtgtgtgcaggctctgcgcgtacagccggaattttttgttcccatggcagca
gcaaactcgactccgcccggctctctggacctgagccagcccgggtttgcgaaggagatc
ctgggaactaagctggaggtgaagtacctctgctcggactgcaggaacatattgaggcgg
cccttccaggcacagtgcgggcatcgctactgctcctattgcttgaagaaaatcataagt
tctggacctcagaagtgtgcgagctgcattcaggaaggaatatacgaagaaggaatttct
attttggaaacgagctctgctttcccagacaacgcagctcgtcgggaggtggaaagtctg
cccgctgtctgtattaatgagggctgcacgtggaaggggactattaaagaatatgagagc
tgccatgaggggaactgcccgttcctgctgattgagtgccaggcatgcagaggtgtgatc
cctctgaatgagaaggagcgccactctgagcgggagtgccctgagagaaccctcaactgc
aaatactgcaaatcacttttctacttccctgatattaaggctcacgacgaggtctgccca
aaatttccattgacttgtgatggctgcgggaagaagaagatccccagagagaagtttcag
gaccacgtgaagaactgcggcaaatgcaaagtgccttgcagattcaaggttgtcggctgt
gctgagatggtggaaaatgaaaagctaccagaacacgaaagcaagtgcctggcagagcat
ctatacatgctgctgagttttgtgctcagcctcaagagtggatctggagacctgaagcac
cttcctgccattccctcatcacagagcagctccccgctgctggcagcaaactccctgtgc
ccggagtcggagctcttcaaatccctggagctcttgggaaggtgtgacgccctggagaag
aaaacagtgacctttgagaacatcgtctgcgtgctcaatagagaggtagaaagggtatct
ctgacagctgaagcgtacagccggcagcatcgattagaccaggagcagatcgagacgctg
agtaacaaggttcggcagctggaaaggagcattgggctgaaagacctggccatggctgag
atggaggagaagatccgcaacatggaggcttccacctacgatggtgttttcatctggaag
ataacagaatttgccaggaagcgccaggaggcgatcacgggccgctctccggcgatcttc
tctccagctttctacacgagcaagtatggctacaagatgtgtctgcgcgtttacctgaac
ggggatggcaccgggcgtgggacccatctgtccctgttcttcgtggtgatgaaaggaccc
aacgatgcgctcctgcgttggcccttcaaccagaaggtgggtttgggttggagcccccag
cactgcctgcagccatcagctgctccggggctgaaagcgtcccgtcctgcaggcagggtg
tggggaacggcgagggctgcgggacagcgtgctggagagagcagagccgtgctgctgcca
cggggccaacccacctctgcgtgctgcgctgcctgcagtcggtgcttgcacagcatcacc
cattcagatttcagcttctgggctttgcaaaacgcgtaa

DBGET integrated database retrieval system