KEGG   Gallus gallus (chicken): 417312Help
Entry
417312            CDS       T01006                                 

Gene name
MAP2K4
Definition
mitogen-activated protein kinase kinase 4
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Toll-like receptor signaling pathway
GnRH signaling pathway
Influenza A
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:gga04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:gga04012]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:gga04620]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:gga04912]
Human Diseases; Infectious diseases; Influenza A [PATH:gga05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
18
AA seq 432 aa AA seqDB search
MLWLCQAAVGLLSVCLSECTPVCSTAFLGFQINFCEKAQSKRKALKLNFANPPFKSTARF
TLNTSGVPFQNPHIDTQATLGSNHIVPFSFKRREADLIQKLSSRLQERLRTHSIESSGKL
KISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLM
DLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGK
ITLATVKALNHLKENLKIIHRDIKPSNILLDRNGNIKLCDFGISGQLVDSIAKTRDAGCR
PYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQ
LSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERTVDVACYVCKILDQ
MPATPSSPMYVD
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggctctgccaggccgcggttggtctcctgtctgtgtgcttgtctgagtgcact
cctgtgtgtagtactgcatttctcggctttcagataaacttctgtgaaaaggcacaaagt
aaacgcaaagcgctgaagttaaattttgcaaatccacctttcaagtccacggcaaggttt
actctgaacacctcaggagttcctttccaaaatccacacattgatacacaagcaacactg
ggtagtaatcacattgtcccgttcagtttcaaaaggagagaagcggacctcatccagaaa
ctttccagcaggctacaagagagactgagaacacacagcattgaatcatcaggaaaattg
aagatttcccctgaacagcattgggattttacagcagaggacttgaaagaccttggagaa
attggacgaggcgcttatggttctgtcaacaaaatggtccacaaaccaagtgggcaaatt
atggcagttaaaagaattcgatcgacagtggatgaaaaagaacagaagcagcttctgatg
gaccttgatgtagtaatgcgaagcagtgactgcccatatattgttcagttttatggtgca
ctcttcagagagggtgactgttggatctgtatggagctcatgtctacctcgtttgataag
ttttacaaatatgtatatagtgtattagatgatgttattccagaagaaatcctaggcaaa
atcactttagctactgtgaaagcactaaaccacttaaaagaaaacttgaaaatcattcac
agagatatcaaaccttccaatattcttctggacagaaatggaaatattaaactctgtgac
tttggcattagtggacagcttgtggactccattgccaaaacacgagatgcagggtgccgg
ccgtacatggcgccggaaaggatagatcccagcgcatccaggcaaggctatgacgtccgc
tcagacgtctggagcttggggattacactgtatgagctggccacagggcgattcccctac
cccaaatggaacagtgtgtttgaccagttgacgcaagtagtaaaaggagacccaccacag
ctgagtaactcagaggaaagggaattctccccaagtttcatcaactttgtcaacttgtgc
cttacaaaggacgagtccaaaaggccaaagtacaaagagcttctgaaacatcccttcatt
ctgatgtatgaggaacgcacagtggatgttgcatgctatgtttgtaaaatcctggatcaa
atgccagcaactcccagctctccaatgtatgtcgattga

DBGET integrated database retrieval system