KEGG   Gallus gallus (chicken): 417355Help
Entry
417355            CDS       T01006                                 

Gene name
JMJD6, PTDSR
Definition
(RefSeq) jumonji domain containing 6 (EC:1.14.11.-)
  KO
K11323  
histone arginine demethylase JMJD6 [EC:1.14.11.-]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     417355 (JMJD6)
Chromosome [BR:gga03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    417355 (JMJD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
18
AA seq 414 aa AA seqDB search
MNHKSKKRIREAKRSARPELKDSLDWTRHNYCETFPLSPAACKDNVERADALQLTVEEFV
ERYEKPYKPVVLLNAQVGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEY
METTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPP
RSGTGIHIDPLGTSAWNALVQGHKRWCLFPTSTPRELIKVAREEGGNQQDEAITWFNVIY
PRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTIAITQNFASCTNFPVVWHK
TVRGRPKLSRKWYRILKQEHPDLAALADSVDLQESTGIASDSSSDSSSSSSSSSSDSDSE
CDSGSETEGMMHRRKKRRTCSMMGNGDTTSQDDCVSKERSSSRIRESCGGRSYP
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacaagagcaagaagcggatccgcgaggcgaagcgcagcgcccggcccgagctg
aaggactcgctggattggacccgtcacaactactgcgagacctttccgctcagccccgct
gcctgcaaggataacgtggagcgggcagatgcactccagctcacagtggaggagtttgtg
gagcgttatgaaaagccgtacaagcccgtagtcctgctgaacgcccaggtgggctggtct
gcacaggagaagtggactctggagcggctgaaacgcaagtacaggaaccagaagttcaaa
tgcggggaggacaatgatggttactctgtgaagatgaagatgaaatactacattgagtac
atggaaaccacgcgtgatgacagcccgctgtacatatttgacagcagttatggagagcat
cccaagcgcaggaaactcctggaggactacaaagtacccaagttcttcactgatgatctg
tttcagtatgcgggggagaaacgaaggccgccttacagatggtttgtgatgggcccacct
cgttctgggacaggaattcacatcgaccccttgggaaccagcgcgtggaatgccttggtg
cagggacacaagcgttggtgcctgttccccaccagcactcccagagagctgatcaaagtg
gcgcgggaggagggaggtaaccagcaggatgaagccatcacgtggttcaacgtcatatac
ccaaggacacagcttcccacctggccccctgaattcaaacccctggaaatcttgcagaag
ccaggagagactgtttttgtaccaggtggttggtggcacgtagttctcaacctggacaca
acgatcgccatcacacagaactttgccagctgtaccaacttccccgtggtgtggcacaag
acagtgagagggagacccaaattgtcacggaagtggtacaggatcttaaagcaggagcat
cctgacttggcagcactggctgattcagttgacctacaggagtctactggtattgcttct
gatagctctagtgattcttccagctcctcgagttccagctcctccgactctgattcagag
tgtgactctggctccgagacagaggggatgatgcaccggaggaaaaagaggaggacgtgc
agcatgatgggtaacggtgatacaacttcccaggacgactgcgtgagcaaagagcgcagc
tcctccaggattagggaatcttgtggaggccgcagttacccctga

DBGET integrated database retrieval system