KEGG   Gallus gallus (chicken): 417445Help
Entry
417445            CDS       T01006                                 

Gene name
MAP2K6
Definition
mitogen-activated protein kinase kinase 6
Orthology
K04433  
mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Toll-like receptor signaling pathway
GnRH signaling pathway
Influenza A
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    417445 (MAP2K6)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    417445 (MAP2K6)
  Endocrine system
   04912 GnRH signaling pathway
    417445 (MAP2K6)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    417445 (MAP2K6)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     417445 (MAP2K6)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   417445 (MAP2K6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
18
AA seq 334 aa AA seqDB search
MSQSRGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGEENFEVKADDLEPISELG
RGAYGVVEKMRHMPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKHVIDKGLTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINTQGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKETDVASFVKLILGD
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtcgagaggcaaaaagagaaaccctgggctgaaaattcctaaagaagcattt
gagcaaccacagacgagctccacgccacccagggatctagactccaaagcctgcatctct
attggagaggagaactttgaggtgaaagccgatgacctggagcccatctcggagctggga
cgaggtgcatatggggtggtggagaagatgcggcacatgcctagcgggcagatcatggca
gtgaagcgcatccgagccacggtgaacagccaagaacagaagaggttattgatggatctg
gatatctccatgaggacggtagattgccccttcaccgtcactttctatggagcacttttc
cgagagggagacgtgtggatttgcatggagctgatggatacctcactggacaaattctac
aagcatgtcattgacaaaggcctgacaattcctgaggacatcttagggaaaatagctgtc
tctattgtaaaagcactagaacatctacacagtaagctctccgtgatccacagagatgta
aagccctctaacgtgttgatcaatacgcaggggcaggtgaaaatgtgcgattttggaatt
agcggttacctcgttgactcggttgctaaaaccatggatgctggatgcaaaccctacatg
gctcctgaaagaattaacccggagttgaaccagaaggggtacagcgtcaaatctgatatc
tggagcctggggatcacgatgatcgagctggccatcctgcgctttccctacgactcctgg
gggacgcccttccagcagctcaagcaggtggtggaggagccgtcgccgcagctcccggca
gacaagttctcagcagagttcgtcgattttacctcgcaatgcttgaagaagaattccaaa
gaacggccaacatacccagagcttatgcaacatcctttcttcaccctgcacgaatccaaa
gagacagacgtcgcctcttttgtcaaactcatcctgggagactga

DBGET integrated database retrieval system