KEGG   Gallus gallus (chicken): 417463Help
Entry
417463            CDS       T01006                                 

Gene name
POM121, POM121C
Definition
POM121 transmembrane nucleoporin
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
gga  Gallus gallus (chicken)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    417463 (POM121)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
19
AA seq 955 aa AA seqDB search
ARGPVLEQLLSPVALLPGSSPDPCAKETVLNAIKESRKRAVEEEEEEEQALGNDQDSKRR
RHDSSGSGQSAFEPLVANGAPASLIPKPGSLKRGLASQCPDDCSNKRSRTSSMSSLNNTY
TSGIPSSLRNAIASSYSSSRGLTQLWKRSGVSVSPLSSPASSRPQTPEWPIKKAREEETH
CSNTSTPVKSDKELQTEKVVEMPVRRKRGSLSPPSASGSSGKRKRKIQLLSSRRGDQLAL
PPPPQLGYSITSEDLDAEKKAALQWFNKVLEDKPDPVPNTTAETTPVSRPLAFTVTTGTS
STPVSTAPVPASSNLLLDSLKKMQSSQAAPVPADSTGATIAFQTSSSASQLPAPAVSLES
NSQPATSADTKPVPVLSTAALSISPTSGTQPASSVAPPATTELGPTPSKPPSVLKPNILF
GAPSAPPASQPAVTAAAAVPTTTPVFKPIFGALPKSESTAPGTTVISAVVTASVSSAPSS
APSTTTMFKPIFGSVTTASSPAKVSPFAFKPLSQPASAAEVPAASTTTLAGFTALPNVIF
TTAATTATTLNSSTDATIKPVFSFGLNPPASTSTNLTVTTTASTSVSQPFVFGGLSSSAT
STAPTFAAPVFQFGKPAPATVSATASVTGGPAFGQAPANSTAPTTTAGFSIFGSTTLTSS
APATAGQPALTFGSSTSAFGGTFSTSVKPLPPYSGAASQPAFSASAADSQLPTSKPAAGP
VGFAPPFSFGAPTAQSTAQPVFGSSAPPTFGTSGTQVAFGTTTSVFSFGTATSTTASFGS
GTQTTSSSTGTAVFGTAPSPFTFGAAAQPGPSAGAFGLSTPALSSGSPAVPFSFGAGQSG
AAAAATPFGSSLTPGTLGAPSQSTPFAFTVPSTPDAKPVFGGTPAPTFGQSTPVPGAVGS
GGGSLSFGTPSTPASAFPGVGTSFGPSTPAFSIGAGSKTGARQRLQARRQHTRKK
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
gcccgcggccccgtgctggagcagctcctgtcgcccgtcgccctcctgcccggcagcagc
ccggacccgtgtgcaaaggagacggtgctgaacgccatcaaggagagcagaaagagggcg
gtggaggaggaggaggaggaggagcaggcgctgggtaacgatcaggacagcaagcgaagg
cgccatgacagcagcggaagtgggcagtcggcatttgagcccctggtcgccaacggtgcc
cccgcctctcttatacccaagcctggctctctgaagagaggccttgcttcgcagtgcccc
gatgactgctcaaacaagaggtcacgcacctcctccatgagctccctcaacaatacgtac
acaagtggaatccccagctccctgcgcaatgccatcgccagctcctacagctccagccgg
ggcctcacgcagctgtggaagaggagtggtgtgagtgtgtcaccgctgtccagccctgca
tcctcccgtccccagacaccagagtggcctatcaagaaagccagggaggaggagacgcat
tgctccaacacttccaccccagtgaaatcagacaaggagctgcagacggagaaagtggtg
gagatgcctgtgcggaggaagcgtggttccctgagcccaccatctgcatcggggagcagt
ggcaagcgcaagcggaagatccagttgctgtcgtctcgccggggggaccagctggcactg
cccccgccgcctcagctgggctactccattacgtcggaggacctggacgcggagaagaag
gcagcgttgcagtggttcaacaaagtcttggaggataagcctgatccagtccccaacacc
actgcagagactacacctgtgtccaggccattggcattcacagtgaccacagggacctcc
tcaacgcctgtgtcaacagctcctgtcccagccagcagcaacttgctcctggacagcctg
aagaagatgcagagcagccaggctgcacctgtgccagcagactccactggagctacgata
gcattccagacatcttcatcagcatcacagctgcctgctcctgccgtgtcactggagtca
aattctcaacctgcaacctctgctgacaccaagcctgtgcctgtgctaagcacagctgct
ctttccatctcccctacctcggggacacagcctgccagcagcgtggcacctcctgcgacc
acagagctgggcccaacccccagcaaacctccctccgtgctgaagccgaacatccttttt
ggggcaccgagtgcccctcctgccagccagccggcagtgactgcagctgctgcagtgccc
accacaacccccgtcttcaaacccatctttggtgctttgccaaaaagtgagagcacagca
ccgggtacgacagtcatctctgccgtagtcactgcgtcggtgagctcagccccttcctca
gcaccttccaccaccaccatgttcaagcccatctttggcagcgtgacaacagcttcatct
ccagcaaaggtctctccttttgccttcaaaccactgtcacagccggcttcagctgcagaa
gtgccagcagcctccacaaccacgctggcaggattcacggctctgccaaacgtcatcttc
accaccgcagctacgactgccaccacgctcaactcctccacggatgccaccattaaacca
gtgttcagctttggactcaacccgcctgcctccaccagcaccaacctgacggtgaccacc
accgcatccaccagtgtgtcacagccctttgtgtttggtggcctgtccagctctgccacc
agcacggcacccacctttgctgccccagtgttccagtttggaaagccggctccagccacc
gtctctgccactgccagcgtcacgggaggcccagcgtttggccaagcacctgcaaactca
acagcacccaccaccactgcgggcttcagcatatttgggagcaccacgttgacatcttct
gccccggccaccgcaggccaaccggcgctgacgtttggctcctccacttcagcttttggc
ggtactttcagcacaagtgtgaagccactgccgccgtactcaggggcagcgagccagccc
gcattcagtgccagcgctgcagacagccagctgcccacaagcaagcctgccgcgggccct
gtcggctttgctcccccgtttagttttggggcacccacggcccagtccactgctcagcct
gtgttcggcagcagcgctccgccgacctttggcaccagcggcacccaggtggcgttcggg
accaccacgtcggtgttctccttcgggacggccacctctaccacagccagcttcggttcc
ggcacccagaccacgagcagcagcactggcaccgccgtcttcggcaccgcgccgtctcca
ttcacctttggggcagccgcccagccgggcccctctgccggtgcctttgggctcagcaca
cccgccctgagcagcggctcacctgcagtgcccttcagctttggtgccgggcagagcgga
gcggctgcagccgccacaccgtttggttcttccctaacgccgggcacgctgggagcgccg
agccagagcacgccatttgccttcactgtgcccagcacgcctgatgccaagcccgtgttt
ggaggaactcctgcccccacctttgggcagagcacacctgtcccgggagcagtggggagt
ggcggcggcagcctttccttcgggacgcccagcactcctgcctcagccttcccaggagtt
ggcacgtcctttggtccgtcaaccccggcgttttccatcggggcaggatccaagactggc
gctcggcagcggctgcaggcacggcgacagcacacccgcaaaaagtaa

DBGET integrated database retrieval system