KEGG   Gallus gallus (chicken): 417463Help
Entry
417463            CDS       T01006                                 

Gene name
POM121C, POM121
Definition
(RefSeq) POM121 transmembrane nucleoporin C
  KO
K14316  
nuclear pore complex protein Nup121
Organism
gga  Gallus gallus (chicken)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    417463 (POM121C)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     417463 (POM121C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
19
AA seq 1106 aa AA seqDB search
MVGAGPGAAPWGRRGAALAVLGLALAALACLVLQGALLGAAALGAAGAWCAMRPGPPAPR
PPAKAAANGAPAAPSGRFAKAAPRRPGSGLCSPPQAPRRRYPLPLSRSAVPGALPAACWD
GVVRRSTAWARRAGPARSPVTVRIGRPGGPARGPVLEQLLSPVALLPGSSPDPCAKETVL
NAIKESRKRAVEEEEEEEQALGNDQDSKRRRHDSSGSGQSAFEPLVANGAPASLIPKPGS
LKRGLASQCPDDCSNKRSRTSSMSSLNNTYTSGIPSSLRNAIASSYSSSRGLTQLWKRSG
VSVSPLSSPASSRPQTPEWPIKKAREEETHCSNTSTPVKSDKELQTEKAVVEMPVRRKRG
SLSPPSASGSSGKRKRKIQLLSSRRGDQLALPPPPQLGYSITSEDLDAEKKAALQWFNKV
LEDKPDPVPNTTAETTPVSRPLAFTVTTGTSSTPVSTAPVPASSNLLLDSLKKMQSSQAA
PVPADSTGATIAFQTSSSASQLPAPAVSLESNSQPATSADTKPVPVLSTAALSISPTSGT
QPASSVAPPATTELGPTPSKPPSVLKPNILFGAPSAPPASQPAVTAAAAVPTTTPVFKPI
FGALPKSESTAPGTTVISAVVTASVSSAPSSAPSTTTMFKPIFGSVTTASSPAKVSPFAF
KPLSQPASAAEVPAASTTTLAGFTALPNVIFTTAATTATTLNSSTDATIKPVFSFGLNPP
ASTSTNLTVTTTASTSVSQPFVFGGLSSSATSTAPTFAAPVFQFGKPAPATVSATASVTG
GPAFGQAPANSTAPTTTAGFSIFGSTTLTSSAPATAGQPALTFGSSTSAFGGTFSTSVKP
LPPYSGAASQPAFSASAADSQLPTSKPAAGPVGFAPPFSFGAPTAQSTAQPVFGSSAPPT
FGTSGTQVAFGTTTSVFSFGTATSTTASFGSGTQTTSSSTGTAVFGTAPSPFTFGAAAQP
GPSAGAFGLSTPALSSGSPAVPFSFGAGQSGAAAAATPFGSSLTPGTLGAPSQSTPFAFT
VPSTPDAKPVFGGTPAPTFGQSTPVPGAVGSGGGSLSFGTPSTPASAFPGVGTSFGPSTP
AFSIGAGSKTGARQRLQARRQHTRKK
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atggtgggggccgggccgggcgcggcgccgtggggacggcggggcgcggcgctggcggtg
ctgggcctggcgctggcggctctggcctgcctggtgctgcagggcgcgctgctgggcgcg
gcggcgctgggcgcggcgggggcctggtgcgccatgaggcccggcccgcccgcaccgcgc
ccgcccgccaaagccgccgctaacggagccccggccgccccctcgggccgcttcgcgaag
gccgctccgcgccgcccgggctcggggctgtgctctccgccgcaggccccgcgccgccgc
tacccgctgccgctgtcccggagcgccgtgccgggcgcgctgcccgccgcctgctgggac
ggcgtcgtccggaggagcaccgcctgggcgcgccgcgccggcccggcccgcagtcccgtc
accgtgcgcatcggccggccgggaggccccgcccgcggccccgtgctggagcagctcctg
tcgcccgtcgccctcctgcccggcagcagcccggacccgtgtgcaaaggagacggtgctg
aacgccatcaaggagagcagaaagagggcggtggaggaggaggaggaggaggagcaggcg
ctgggtaacgatcaggacagcaagcgaaggcgccatgacagcagcggaagtgggcagtcg
gcatttgagcccctggtcgccaacggtgcccccgcctctcttatacccaagcctggctct
ctgaagagaggccttgcttcgcagtgccccgatgactgctcaaacaagaggtcacgcacc
tcctccatgagctccctcaacaatacgtacacaagtggaatccccagctccctgcgcaat
gccatcgccagctcctacagctccagccggggcctcacgcagctgtggaagaggagtggt
gtgagtgtgtcaccgctgtccagccctgcatcctcccgtccccagacaccagagtggcct
atcaagaaagccagggaggaggagacgcattgctccaacacttccaccccagtgaaatca
gacaaggagctgcagacggagaaagcagtggtggagatgcctgtgcggaggaagcgtggt
tccctgagcccaccatctgcatcggggagcagtggcaagcgcaagcggaagatccagttg
ctgtcgtctcgccggggggaccagctggcactgcccccgccgcctcagctgggctactcc
attacgtcggaggacctggacgcggagaagaaggcagcgttgcagtggttcaacaaagtc
ttggaggataagcctgatccagtccccaacaccactgcagagactacacctgtgtccagg
ccattggcattcacagtgaccacagggacctcctcaacgcctgtgtcaacagctcctgtc
ccagccagcagcaacttgctcctggacagcctgaagaagatgcagagcagccaggctgca
cctgtgccagcagactccactggagctacgatagcattccagacatcttcatcagcatca
cagctgcctgctcctgccgtgtcactggagtcaaattctcaacctgcaacctctgctgac
accaagcctgtgcctgtgctaagcacagctgctctttccatctcccctacctcggggaca
cagcctgccagcagcgtggcacctcctgcgaccacagagctgggcccaacccccagcaaa
cctccctccgtgctgaagccgaacatcctttttggggcaccgagtgcccctcctgccagc
cagccggcagtgactgcagctgctgcagtgcccaccacaacccccgtcttcaaacccatc
tttggtgctttgccaaaaagtgagagcacagcaccgggtacgacagtcatctctgccgta
gtcactgcgtcggtgagctcagccccttcctcagcaccttccaccaccaccatgttcaag
cccatctttggcagcgtgacaacagcttcatctccagcaaaggtctctccttttgccttc
aaaccactgtcacagccggcttcagctgcagaagtgccagcagcctccacaaccacgctg
gcaggattcacggctctgccaaacgtcatcttcaccaccgcagctacgactgccaccacg
ctcaactcctccacggatgccaccattaaaccagtgttcagctttggactcaacccgcct
gcctccaccagcaccaacctgacggtgaccaccaccgcatccaccagtgtgtcacagccc
tttgtgtttggtggcctgtccagctctgccaccagcacggcacccacctttgctgcccca
gtgttccagtttggaaagccggctccagccaccgtctctgccactgccagcgtcacggga
ggcccagcgtttggccaagcacctgcaaactcaacagcacccaccaccactgcgggcttc
agcatatttgggagcaccacgttgacatcttctgccccggccaccgcaggccaaccggcg
ctgacgtttggctcctccacttcagcttttggcggtactttcagcacaagtgtgaagcca
ctgccgccgtactcaggggcagcgagccagcccgcattcagtgccagcgctgcagacagc
cagctgcccacaagcaagcctgccgcgggccctgtcggctttgctcccccgtttagtttt
ggggcacccacggcccagtccactgctcagcctgtgttcggcagcagcgctccgccgacc
tttggcaccagcggcacccaggtggcgttcgggaccaccacgtcggtgttctccttcggg
acggccacctctaccacagccagcttcggttccggcacccagaccacgagcagcagcact
ggcaccgccgtcttcggcaccgcgccgtctccattcacctttggggcagccgcccagccg
ggcccctctgccggtgcctttgggctcagcacacccgccctgagcagcggctcacctgca
gtgcccttcagctttggtgccgggcagagcggagcggctgcagccgccacaccgtttggt
tcttccctaacgccgggcacgctgggagcgccgagccagagcacgccatttgccttcact
gtgcccagcacgcctgatgccaagcccgtgtttggaggaactcctgcccccacctttggg
cagagcacacctgtcccgggagcagtggggagtggcggcggcagcctttccttcgggacg
cccagcactcctgcctcagccttcccaggagttggcacgtcctttggtccgtcaaccccg
gcgttttccatcggggcaggatccaagactggcgctcggcagcggctgcaggcacggcga
cagcacacccgcaaaaagtaa

DBGET integrated database retrieval system