KEGG   Gallus gallus (chicken): 417506Help
Entry
417506            CDS       T01006                                 

Gene name
MYL10, G2, MLC-2B, MYLC2PL
Definition
(RefSeq) myosin, light chain 10, regulatory
  KO
K12756  myosin regulatory light chain 10
Organism
gga  Gallus gallus (chicken)
Pathway
gga04510  Focal adhesion
gga04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    417506 (MYL10)
  Cell motility
   04810 Regulation of actin cytoskeleton
    417506 (MYL10)
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     417506 (MYL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 417506
NCBI-ProteinID: NP_001090995
CGNC: 50527
Ensembl: ENSGALG00000001793
UniProt: A4UNW1
Position
19
AA seq 165 aa AA seqDB search
MAPKKAKKKVEGGSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKADLRDTFAALGRLNV
KNEELEDMVKEAPGPINFTVFLTMFGEKLKGTDPEETILNAFKIFDPEGKGHIKADYIKE
MLMTQADRFSQEEINQMFAAFPPDVSGNLDYKNLCYVITHGEEKD
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggctccaaaaaaggcaaagaagaaggtagaaggtggttccaatgtattctctatgttt
gaacaaacccagatccaggagttcaaagaagcatttaccatcatggatcagaacagggat
ggctttattgataaagcagacttgagagacacatttgctgcactgggtcgtctgaatgtc
aagaatgaagagctagaagacatggtgaaggaggcgccaggtcccattaacttcactgtc
tttcttacaatgtttggggaaaaactgaaaggcacggacccagaagaaaccattctgaat
gcttttaagattttcgacccagaaggaaaaggccacataaaggcagactacatcaaagaa
atgcttatgacacaagcagaccggttcagtcaagaagagatcaaccagatgtttgctgct
ttccctccagatgtctctggtaatcttgactataagaacctctgttatgttatcacccat
ggtgaggagaaagactaa

DBGET integrated database retrieval system