KEGG   Gallus gallus (chicken): 417506Help
Entry
417506            CDS       T01006                                 

Gene name
MYL10, MYLC2PL
Definition
myosin, light chain 10, regulatory
Orthology
K12756  
myosin regulatory light chain 10
Organism
gga  Gallus gallus (chicken)
Pathway
Focal adhesion
Tight junction
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:gga04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:gga04510]
Cellular Processes; Cell communication; Tight junction [PATH:gga04530]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
19
AA seq 165 aa AA seqDB search
MAPKKAKKKVEGGSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKADLRDTFAALGRLNV
KNEELEDMVKEAPGPINFTVFLTMFGEKLKGTDPEETILNAFKIFDPEGKGHIKADYIKE
MLMTQADRFSQEEINQMFAAFPPDVSGNLDYKNLCYVITHGEEKD
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggctccaaaaaaggcaaagaagaaggtagaaggtggttccaatgtattctctatgttt
gaacaaacccagatccaggagttcaaagaagcatttaccatcatggatcagaacagggat
ggctttattgataaagcagacttgagagacacatttgctgcactgggtcgtctgaatgtc
aagaatgaagagctagaagacatggtgaaggaggcgccaggtcccattaacttcactgtc
tttcttacaatgtttggggaaaaactgaaaggcacggacccagaagaaaccattctgaat
gcttttaagattttcgacccagaaggaaaaggccacataaaggcagactacatcaaagaa
atgcttatgacacaagcagaccggttcagtcaagaagagatcaaccagatgtttgctgct
ttccctccagatgtctctggtaatcttgactataagaacctctgttatgttatcacccat
ggtgaggagaaagactaa

DBGET integrated database retrieval system