KEGG   Gallus gallus (chicken): 417520Help
Entry
417520            CDS       T01006                                 

Gene name
POR, CPR
Definition
(RefSeq) cytochrome p450 oxidoreductase
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     417520 (POR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 B DUF3755
Motif
Other DBs
NCBI-GeneID: 417520
NCBI-ProteinID: NP_001182725
CGNC: 1457
Ensembl: ENSGALG00000002053
UniProt: F1P2T2
Position
19
AA seq 676 aa AA seqDB search
MGDAGMESTVSPPEGTAQDSFLSMTDVFLISLITGLFTYWFFFRKKKEEIPDLPKIQTVS
SPARDSSFIEKMKKTGRNIVVFYGSQTGTAEEFANRLSKDAHRYGLRGMAADPEEYDLSD
LSRLSEIDKSLAVFCMATYGEGDPTDNAQDFYDWLQEADTDLSGLRFAVFGLGNKTYEHF
NAMGKYVDKRLEELGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEESS
IRQYELVVHTDVNMNKVYTGEMGRLKSYENQKPPFDAKNPFLAVVTENRKLNEGGERHLM
HLELDISNSKIRYESGDHVAVYPANDASLVNQLGEILGTDLDTVMSLNNLDEESNKKHPF
PCPTSYRTALTYYLDITNPPRTNVLYELAQYATDTGEQEQLRKMASSSAEGKALYLSWVV
EARRNILAILQDMPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSIHICAVTVEYETK
TGRLNKGVATNWLKDKVPNENGRNSLVPMYVRKSQFRLPFKPSTPVIMIGPGTGIAPFIG
FIQERAWLKEQGKEVGETVLYYGCRREREDYLYRQELARFKQEGVLTQLNVAFSRDQAEK
VYVQHLLKKNKEHIWKLVNDGNAHIYVCGDARNMARDVQNTFYEIVSEYGNMNQSQAVDY
VKKLMTKGRYSLDVWS
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgggggatgctggcatggaatcgacagtctcccctcctgaaggcactgcacaagactct
ttcttgagcatgactgatgtgtttctcatctcactcatcactgggctttttacttattgg
ttcttcttccgcaagaaaaaggaggaaatccctgatctccccaaaatccaaacagtatcg
tctccagcaagagatagcagcttcattgagaagatgaagaagacgggccgaaacatagtg
gttttttatggttcccagacgggcacagcagaggaatttgccaatcgcctctccaaagat
gctcaccgctatggtctccgtggcatggcagcagatcctgaggagtatgacttgtcggac
ctgagtcgcctctctgagattgacaagtccttagccgtgttctgtatggccacgtatggt
gagggtgatcctacagacaatgcccaggacttctatgactggctgcaggaggctgacact
gacctgtcaggtctccgctttgcagtctttgggctggggaacaagacttatgagcacttc
aatgccatgggaaaatatgtggacaagagactggaggagcttggagcccagcgcatcttt
gagcttgggctgggagatgatgatggcaacctggaagaagacttcatcacctggagggag
cagttctggccagcagtgtgtgagcactttggggtggaggctacaggagaggaatccagc
atccgccaatacgagctggtggtgcacacagatgtgaacatgaacaaggtgtacactggg
gagatgggccggctcaagagctacgagaaccagaagccgccatttgatgccaagaacccc
ttcctggctgtggttacagagaaccgtaagctgaacgagggtggggaacgacacctgatg
cacctggagctggatatctccaattccaaaatcaggtatgagtctggggaccacgtggct
gtgtatccggccaacgacgcatctctggtgaatcagttgggtgagattctgggcacggat
ctggatacagtcatgtcactgaacaatttggatgaggaatccaacaagaaacaccccttc
ccctgccccacctcctaccgcacagccctgacctactacctggacatcaccaacccgccc
cgcaccaacgtgctctacgagctggcccagtatgccacggacactggcgagcaggagcag
ctccgaaagatggcatcgtccagtgctgaggggaaggctctctacctcagctgggtggtg
gaggcccggaggaacatcctggccatcctgcaggacatgccctcgctgcgtccccccatc
gaccacttgtgtgagctcctgccccgtctgcaggcccgctactactccatcgcctcctcc
tccaaggttcaccccaactccatccacatctgcgctgtgacggtggagtacgagaccaag
acgggacggctgaacaaaggggtggccaccaactggctgaaggacaaagtgcccaacgag
aacgggaggaactccctggtgcccatgtatgtccggaagtcgcagttccgcctgcccttc
aaacccagcacgcccgtcatcatgattggaccaggcactggcatagcccccttcatcggc
ttcatacaggagcgagcctggctgaaggagcagggcaaagaggtgggtgagacggtgctg
tactacggctgccgccgtgagcgggaggactacctgtaccgccaggagctggcccgtttc
aagcaggagggcgtcctcacccagctcaacgtcgccttctccagggaccaggctgagaag
gtttatgtccaacacttactaaagaagaacaaggaacacatctggaagctggtgaatgat
ggaaatgctcatatctatgtgtgtggggatgcccgcaacatggcccgggacgtgcagaac
actttctatgagatcgtgtctgagtatgggaacatgaatcagtctcaggccgtggactat
gtaaagaaactgatgactaagggccggtactctttggatgtgtggagctaa

DBGET integrated database retrieval system