KEGG   Gallus gallus (chicken): 417520Help
Entry
417520            CDS       T01006                                 

Gene name
POR
Definition
P450 (cytochrome) oxidoreductase (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
19
AA seq 676 aa AA seqDB search
MGDAGMESTVSPPEGTAQDSFLSMTDVFLISLITGLFTYWFFFRKKKEEIPDLPKIQTVS
SPARDSSFIEKMKKTGRNIVVFYGSQTGTAEEFANRLSKDAHRYGLRGMAADPEEYDLSD
LSRLSEIDKSLAVFCMATYGEGDPTDNAQDFYDWLQEADTDLSGLRFAVFGLGNKTYEHF
NAMGKYVDKRLEELGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEESS
IRQYELVVHTDVNMNKVYTGEMGRLKSYENQKPPFDAKNPFLAVVTENRKLNEGGERHLM
HLELDISNSKIRYESGDHVAVYPANDASLVNQLGEILGTDLDTVMSLNNLDEESNKKHPF
PCPTSYRTALTYYLDITNPPRTNVLYELAQYATDTGEQEQLRKMASSSAEGKALYLSWVV
EARRNILAILQDMPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSIHICAVTVEYETK
TGRLNKGVATNWLKDKVPNENGRNSLVPMYVRKSQFRLPFKPSTPVIMIGPGTGIAPFIG
FIQERAWLKEQGKEVGETVLYYGCRREREDYLYRQELARFKQEGVLTQLNVAFSRDQAEK
VYVQHLLKKNKEHIWKLVNDGNAHIYVCGDARNMARDVQNTFYEIVSEYGNMNQSQAVDY
VKKLMTKGRYSLDVWS
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgggggatgctggcatggaatcgacagtctcccctcctgaaggcactgcacaagactct
ttcttgagcatgactgatgtgtttctcatctcactcatcactgggctttttacttattgg
ttcttcttccgcaagaaaaaggaggaaatccctgatctccccaaaatccaaacagtatcg
tctccagcaagagatagcagcttcattgagaagatgaagaagacgggccgaaacatagtg
gttttttatggttcccagacgggcacagcagaggaatttgccaatcgcctctccaaagat
gctcaccgctatggtctccgtggcatggcagcagatcctgaggagtatgacttgtcggac
ctgagtcgcctctctgagattgacaagtccttagccgtgttctgtatggccacgtatggt
gagggtgatcctacagacaatgcccaggacttctatgactggctgcaggaggctgacact
gacctgtcaggtctccgctttgcagtctttgggctggggaacaagacttatgagcacttc
aatgccatgggaaaatatgtggacaagagactggaggagcttggagcccagcgcatcttt
gagcttgggctgggagatgatgatggcaacctggaagaagacttcatcacctggagggag
cagttctggccagcagtgtgtgagcactttggggtggaggctacaggagaggaatccagc
atccgccaatacgagctggtggtgcacacagatgtgaacatgaacaaggtgtacactggg
gagatgggccggctcaagagctacgagaaccagaagccgccatttgatgccaagaacccc
ttcctggctgtggttacagagaaccgtaagctgaacgagggtggggaacgacacctgatg
cacctggagctggatatctccaattccaaaatcaggtatgagtctggggaccacgtggct
gtgtatccggccaacgacgcatctctggtgaatcagttgggtgagattctgggcacggat
ctggatacagtcatgtcactgaacaatttggatgaggaatccaacaagaaacaccccttc
ccctgccccacctcctaccgcacagccctgacctactacctggacatcaccaacccgccc
cgcaccaacgtgctctacgagctggcccagtatgccacggacactggcgagcaggagcag
ctccgaaagatggcatcgtccagtgctgaggggaaggctctctacctcagctgggtggtg
gaggcccggaggaacatcctggccatcctgcaggacatgccctcgctgcgtccccccatc
gaccacttgtgtgagctcctgccccgtctgcaggcccgctactactccatcgcctcctcc
tccaaggttcaccccaactccatccacatctgcgctgtgacggtggagtacgagaccaag
acgggacggctgaacaaaggggtggccaccaactggctgaaggacaaagtgcccaacgag
aacgggaggaactccctggtgcccatgtatgtccggaagtcgcagttccgcctgcccttc
aaacccagcacgcccgtcatcatgattggaccaggcactggcatagcccccttcatcggc
ttcatacaggagcgagcctggctgaaggagcagggcaaagaggtgggtgagacggtgctg
tactacggctgccgccgtgagcgggaggactacctgtaccgccaggagctggcccgtttc
aagcaggagggcgtcctcacccagctcaacgtcgccttctccagggaccaggctgagaag
gtttatgtccaacacttactaaagaagaacaaggaacacatctggaagctggtgaatgat
ggaaatgctcatatctatgtgtgtggggatgcccgcaacatggcccgggacgtgcagaac
actttctatgagatcgtgtctgagtatgggaacatgaatcagtctcaggccgtggactat
gtaaagaaactgatgactaagggccggtactctttggatgtgtggagctaa

DBGET integrated database retrieval system