KEGG   Gallus gallus (chicken): 417525Help
Entry
417525            CDS       T01006                                 

Gene name
AP2B1
Definition
(RefSeq) adaptor related protein complex 2 beta 1 subunit
  KO
K11825  AP-2 complex subunit beta-1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    417525 (AP2B1)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    417525 (AP2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N Cnd1 B2-adapt-app_C HEAT_2 HEAT Alpha_adaptinC2 Arm Cnd3 CLASP_N RTP1_C1 Arm_2 Sec7_N
Motif
Other DBs
NCBI-GeneID: 417525
NCBI-ProteinID: XP_015151502
CGNC: 1528
Ensembl: ENSGALG00000042125
Position
19
AA seq 937 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTATTNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLVGQTYIPSSVPATFAPSPTPAVVSSGLNDLFELSSGIGMAPGGYVAPKSVWLPAVKA
KGLEISGTFSHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQ
SIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLAT
WKDIPNENELQFQIKDCHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWIL
AELRIQPGNPNYTLSLKCRAPEVSQYIYQAYDAILKN
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgacggactccaaatacttcacgaccaataaaaaaggagagatttttgaactcaaggct
gaactcaataatgaaaagaaggagaaaaggaaagaagctgtaaagaaggttattgcagcc
atgactgtggggaaggatgtcagctcactctttcctgatgttgtgaactgcatgcagact
gacaatctggagttgaagaagctggtgtacctgtacctgatgaactacgccaaaagtcag
ccagacatggctattatggctgtcaacagctttgtgaaggactgtgaagacccaaaccct
ctcatccgtgctctagccgtccgtaccatgggatgtatcagggtggacaagatcacagag
tatttgtgtgagcctcttcgcaagtgtctgaaggatgaagacccttatgttcgaaaaact
gcagctgtctgcgtggcgaagctgcatgacatcaatgcccagatggtggaggaccaagga
tttctggattccctgcgtgacctgattgcagactcgaatcccatggtggtagcaaatgct
gttgctgctttgtcagaaatcagcgagtcgcatcccaacagcaacctgctggacctgaac
cctcagaacatcaacaagctgctgacagctttaaatgaatgcacagagtgggggcagatc
ttcatcctggactgcctgtccaactacaatcccaaggatgatcgtgaagctcaaagtatt
tgtgagcgggtgacccctcggctgtcccatgccaactcagcagtggtgctgtcagcagtg
aaagttctgatgaagttcctggagcttctccccaaggactcagactattacaacatgctg
ctgaagaagcttgcccctccgctggttaccctgctgtctggagagcctgaagtccagtat
gtcgccctgaggaacatcaacttgattgtgcagaaaaggcctgaaatcctgaagcaggaa
atcaaggtgttctttgtgaagtacaacgaccccatctacgtcaaactggagaaactggac
atcatgatccgcctggcttctcaagcaaacattgcccaggtcctggcagagctgaaggaa
tatgctactgaggtagatgttgactttgttcgtaaggctgttcgagctattggacgctgt
gccatcaaggttgagcaatccgcggagcgctgtgtgagcacactgctggacctcatccag
accaaggtcaactacgtggtgcaggaggccatcgtcgtcattaaggacatcttccgcaag
taccccaacaagtatgaaagcatcattgccaccctgtgtgagaacctagattccctggat
gaaccagatgccagagctgccatgatctggatagtgggtgaatatgcagaacgaattgac
aatgcagatgaactgttggagagttttctggagggctttcatgacgaaagtacccaggtg
cagctcacccttctgactgctatagtgaagctgttcttgaaaaagccttctgagacacag
gagctggttcagcaggtcctcagcctagccacgcaggattctgacaacccagacctgcgg
gaccgtggctacatctactggcgccttctttccacggacccagtgactgccaaagaagtg
gtcttatcagaaaagccactgatctccgaggagactgatctgattgaacccactctgctg
gatgagctgatctgccatattgggtctctggcttctgtgtaccacaaaccacccaatgct
ttcgtggaagggagccacggtatccaccgcaagcacttgccaattcaccatggaagcact
gatgcaggagacagccccgtggggacaacagccacaacaaacctggagcagccacaggtc
atcccatcgcagggcgacctgctgggtgacctgctcaacttggacctgggaccccctgtc
aacgttccccaggtgtcctccatgcagatgggtgccgtggacctcctgggagggggtttg
gacagcttggtggggcagacctacattccctcttctgtgccagccacctttgccccttca
cccaccccagccgtggtgagcagtggactcaacgatctctttgagctctcatctggtata
ggcatggctccaggaggatatgtggctcccaagtctgtttggttgcctgcagtgaaagct
aaagggctggagatctcaggcacattcagtcacagacagggacacatctacatggagatg
aacttcaccaataaggctttgcagcacatgactgactttgccattcagttcaacaagaat
agctttggggtcatcccaagcactccgttggccattcacacccctctgatgccaaaccaa
agtattgatgtctctctgcccctcaacaccctgggaccagtcatgaaaatggagcctctg
aacaacctccaggtagctgtgaaaaacaacattgatgtcttttacttcagctgcctaatt
cctctcaacgtgctttttgtggaggatggcaaaatggagcgccaggtcttcctcgcaact
tggaaagacattcccaatgaaaatgagctgcagttccagattaaagactgtcacctgaat
gccgacaccgtctccagcaaactgcagaacaacaacgtctacaccattgccaagaggaat
gtggagggtcaggacatgctctaccagtctctgaagctcaccaatggcatctggatcctg
gctgagcttcgcatccagccgggcaatcccaattacacgctctctctgaaatgccgtgct
cccgaggtgtcccagtacatctaccaggcctacgatgccatcctgaagaactga

DBGET integrated database retrieval system