KEGG   Gallus gallus (chicken): 417668Help
Entry
417668            CDS       T01006                                 

Gene name
AKAP1
Definition
(RefSeq) A-kinase anchoring protein 1
  KO
K16518  
A-kinase anchor protein 1, mitochondrial
Organism
gga  Gallus gallus (chicken)
Brite
Protein phosphatases and associated proteins [BR:gga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     417668 (AKAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
Position
19
AA seq 883 aa AA seqDB search
MALRFRTFFPYAIPGVLALLGCWWIYSHRKKHPSNRNRQAIAIAEGKQKELPENDSPPKT
EACVPQRLPLYPEEERPENETSASLLPAGPMTPSPTRRTRERLDFSRDLSAPAIRTTQPS
TVEDDSEKLEIKGSQDESSVPACVSLSLISKSTKCRSGAAVSPEEDSGSSTNQAKCPSAS
VVPTQRSLGITEEISNAEQSDESSLKPPKESQMPEIALSDTGCMTALHLGLEKEADAPQA
LLTNEVVLSHQDSAVRVLSGSLESACLEQSREEKIPESNDSTVPVCQGEDAHAKGNELER
ERIRGVSLDKEEVEKIEQVAIQIISKVILAATEEVLAGSVSDVSSRICQAAASRVERPQE
RASTAASDQLLAAEAGGGDKNTALKSDAAVPTSLPTEERDQCVTYSSCSALGHLSSPVQG
DTQDHQEKNCVHSESQGVDRTLVASHGGSLGKSHLVMEDSGCSTCASEGGTSVEDPLQNT
MLSVASGQHSDLLSTSATQDTSAEQSSEPSEKPPTLKLPEDSKVPYSNGMLKEDGSDSRH
EGNWAAEMDGDHSGGSDVNSMDSVDSGCALGKTETHQNSKPGGESSKSDLTIWEIEVPKH
LVGRLIGKQGRYVSFLKQTSGAKIYISTLPYSHDFQICHIEGSQHHVEKALSLIGKKFKE
LSLTNIYAPPPPSLALHSLPMTSWLMLPDGVTVEVVVANQVNAGHMFLQQHTHPTFHVLR
SLDQQMYVCYSQPGIPTLPTPVEVGIICAAPGLEGAWWRAQVVGYFKDSGEVEIRYVDYG
GYERVKIDTLRQIRSDFVTLPFQGAEVLLDNVVPLPDEDHFSSEADAAVSEMTRGAALLA
QVTNYDNATGLPLIQLWSMMGDEVVSINRTLVERGFAQWVDNY
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctttacgctttcgcactttcttcccgtacgccatacctggagtgctggcacttctt
ggctgctggtggatctattcccatagaaaaaagcatccaagcaatcgtaacagacaagca
atagccattgcagaagggaagcagaaagaactgccagagaatgactcaccacccaaaact
gaagcgtgtgttcctcaaagactgcctctctacccagaagaggaacgcccagagaatgaa
acctcggcctccctgctgccagcagggccgatgacgccctctcctacgcgtcggactcgc
gagaggttagatttctcacgggacctttcagccccagcaataaggacaactcagcccagc
accgttgaggacgacagtgaaaaactagaaattaaaggttctcaagatgaaagcagcgtc
cctgcttgtgtttctctctctctgatctcaaagagcactaagtgtcgcagcggtgctgca
gtcagccctgaagaggattcaggctctagtacaaaccaagctaagtgcccgtcagcatcg
gtggtgccgacacaaaggtctttgggaatcacggaggagatcagcaatgcagagcagtca
gatgagtcttcacttaagccccctaaggaaagccagatgccagaaattgcgctgtcggat
actggctgtatgacagcccttcacttgggattggagaaggaagccgatgccccacaagcc
cttctcactaatgaagttgtactgagtcaccaggattctgcagttagggtgttatcaggc
agtttggagtctgcctgtttggagcaatctagggaagaaaagatacctgagtcgaatgac
agtactgtacctgtgtgtcagggagaggacgcacatgcaaaaggaaatgaattggagaga
gagaggatcagaggagtgagcttagacaaggaagaagttgagaaaatcgagcaagtagca
atacaaataatttccaaggtcattttggcagcaactgaggaagtgctggctggttctgta
agcgatgtgtccagtcggatctgccaggctgcagccagccgagttgagagacctcaggag
agagcaagcactgctgcttctgatcagctgcttgcggcagaagctggaggaggggataag
aacacagctcttaagagcgatgctgcggtaccaacatccctgccaacagaggaacgtgat
cagtgtgtgacgtattccagctgttcggcacttggccacttatccagcccggttcaggga
gacacacaagaccatcaggaaaagaactgtgtgcacagtgagtcccaaggagttgataga
actcttgtggcaagccatggaggatcactgggaaagtcacacttggttatggaggactct
gggtgcagcacgtgtgcatctgaaggtgggacaagtgtggaggacccgttgcagaacaca
atgctgtctgtcgcatcaggccagcattcggacttactgagcacatctgcaacccaagac
acttctgctgagcagagctcagaaccaagtgaaaaacctcctaccctgaagctacctgaa
gacagcaaagtgccatacagtaatgggatgctgaaagaagacggttcagattcgcgccat
gagggtaactgggcggccgagatggatggagatcactcaggaggttcggatgtaaatagc
atggattctgtggacagtggctgtgccctggggaagacagagacccaccagaactctaag
ccaggaggagaatccagcaagtctgacctcactatctgggaaatcgaggttccaaagcat
ttagttggccgcttgattggcaaacaagggaggtatgtgagcttcctgaagcaaacgtct
ggtgccaaaatttatatctcaacactaccttattcccatgacttccaaatctgtcacatt
gaaggttcccagcatcatgtagaaaaagcactgagccttattggcaagaagttcaaagag
ctgagtctcaccaacatctatgctccacctccaccgtcgctggcgcttcattccctccct
atgacttcctggttgatgctcccagatggagtcactgtagaagtggttgtggctaaccaa
gtcaatgcaggacacatgtttctacagcagcatacgcaccccactttccatgtcctgcgt
agcctggaccagcagatgtatgtctgctattctcaacctggaattccaaccctgccaaca
cctgtggaagttggtattatctgtgctgctccaggcctggagggggcgtggtggcgggca
caagttgttggctacttcaaagacagtggtgaagtggagatcagatatgttgactatgga
ggatacgagagagtgaagattgacacactcagacaaatcaggtctgattttgtaacacta
cctttccaaggagcagaagttttactagacaacgtggtgccacttccagatgaggatcac
ttttcatcagaagctgacgctgctgttagtgagatgaccagaggggcagcactgctggcg
caggtcacgaattatgacaatgcaacaggtctgccactgatacagttgtggagtatgatg
ggagatgaggtggtgtcaataaacagaactctggtggaaagaggatttgctcagtgggtt
gacaactactag

DBGET integrated database retrieval system