KEGG   Gallus gallus (chicken): 417669Help
Entry
417669            CDS       T01006                                 

Gene name
NLK
Definition
(RefSeq) nemo like kinase
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04068  FoxO signaling pathway
gga04310  Wnt signaling pathway
gga04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    417669 (NLK)
   04310 Wnt signaling pathway
    417669 (NLK)
   04068 FoxO signaling pathway
    417669 (NLK)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    417669 (NLK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     417669 (NLK)
Protein kinases [BR:gga01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   417669 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like FTA2 APH
Motif
Other DBs
NCBI-GeneID: 417669
NCBI-ProteinID: XP_015151351
CGNC: 4249
Ensembl: ENSGALG00000005699
UniProt: F1N862
Position
19
AA seq 527 aa AA seqDB search
MSLCGATANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPSSAPA
VHPVQQHASSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAA
VKAHHHQHSQHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPITNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcgcaacagccaacgcaaaaatgatggcggcttacaatggcggtacg
tctgcggcagcggcaggtcaccaccaccaccatcaccaccacctccctcacctccctcct
cctcacctccatcaccaccaccaccctcagcaccacctgcaccccagctccgcgcccgcg
gtccatcccgtgcagcagcacgcttcctcggcagctgcggccgcggcggcggcggcggcg
gcggcggcgatgttgaaccccgggcagcagcagccatatttcccatcgccggcaccgggc
caggcccctggaccagcggcggccgccccagctcaggtacaagctgcagccgcggctgcg
gtcaaagcgcaccatcatcagcactcacaacatccacagcagcaactggatattgagccg
gacagacctattggatacggagcctttggtgttgtctggtcagtaacggatccgcgagat
ggaaagagagttgcactcaaaaagatgcccaacgtcttccaaaatctggtctcttgtaaa
agggtcttccgggagttgaagatgttgtgtttttttaagcatgacaatgtactctctgcc
cttgacatactccagcctccacacatcgactattttgaagaaatctacgttgtcactgaa
ctgatgcagagcgacctccataagattatcgtctctcctcagcctctcagctcggatcac
gtcaaagtttttctttaccagattttaagaggtctgaaatatctacattctgctggcatt
ttacatcgagacatcaaaccagggaacctacttgtgaacagcaactgtgttcttaagatt
tgtgattttggattggccagggtggaagaattagatgaatctcgtcacatgactcaggaa
gttgtcactcagtattatcgagctccagaaatcctgatgggcagccgccactacagcaat
gctattgacatctggtctgtaggctgcatctttgcagaattgctcgggcgaagaatactg
tttcaggcacagagtcccattcagcagctggatctgatcacagacctgctgggaacgccc
tcactggaagcaatgaggacagcgtgcgaaggcgccaaggcacacatactcaggggtcct
cacaaacagccatcccttcctgtcctgtatacactttccagtcaagctactcatgaagca
gttcatctcctttgcagaatgttggtcttcgatccatccaaaagaatatctgctaaggat
gccttagctcacccataccttgatgaagggcggttgcgataccacacctgtatgtgtaaa
tgctgtttttccacatccactggaagagtttatactagtgattttgaacccatcactaat
cccaaatttgatgacacttttgaaaagaacctcagttctgttcggcaggttaaagaaata
attcaccagttcattttggaacagcagaaaggaaacagagtacctctctgcatcaaccct
cagtctgctgcttttaagagctttattagttccacagttgctcaaccttctgagatgcca
ccatctccactggtttgggagtga

DBGET integrated database retrieval system