KEGG   Gallus gallus (chicken): 417669Help
Entry
417669            CDS       T01006                                 

Gene name
NLK
Definition
nemo-like kinase
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    417669 (NLK)
   04310 Wnt signaling pathway
    417669 (NLK)
   04068 FoxO signaling pathway
    417669 (NLK)
 Cellular Processes
  Cell communication
   04520 Adherens junction
    417669 (NLK)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     417669 (NLK)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   417669 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
19
AA seq 527 aa AA seqDB search
MSLCGATANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPSSAPA
VHPVQQHASSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAA
VKAHHHQHSQHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPITNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcgcaacagccaacgcaaaaatgatggcggcttacaatggcggtacg
tctgcggcagcggcaggtcaccaccaccaccatcaccaccacctccctcacctccctcct
cctcacctccatcaccaccaccaccctcagcaccacctgcaccccagctccgcgcccgcg
gtccatcccgtgcagcagcacgcttcctcggcagctgcggccgcggcggcggcggcggcg
gcggcggcgatgttgaaccccgggcagcagcagccatatttcccatcgccggcaccgggc
caggcccctggaccagcggcggccgccccagctcaggtacaagctgcagccgcggctgcg
gtcaaagcgcaccatcatcagcactcacaacatccacagcagcaactggatattgagccg
gacagacctattggatacggagcctttggtgttgtctggtcagtaacggatccgcgagat
ggaaagagagttgcactcaaaaagatgcccaacgtcttccaaaatctggtctcttgtaaa
agggtcttccgggagttgaagatgttgtgtttttttaagcatgacaatgtactctctgcc
cttgacatactccagcctccacacatcgactattttgaagaaatctacgttgtcactgaa
ctgatgcagagcgacctccataagattatcgtctctcctcagcctctcagctcggatcac
gtcaaagtttttctttaccagattttaagaggtctgaaatatctacattctgctggcatt
ttacatcgagacatcaaaccagggaacctacttgtgaacagcaactgtgttcttaagatt
tgtgattttggattggccagggtggaagaattagatgaatctcgtcacatgactcaggaa
gttgtcactcagtattatcgagctccagaaatcctgatgggcagccgccactacagcaat
gctattgacatctggtctgtaggctgcatctttgcagaattgctcgggcgaagaatactg
tttcaggcacagagtcccattcagcagctggatctgatcacagacctgctgggaacgccc
tcactggaagcaatgaggacagcgtgcgaaggcgccaaggcacacatactcaggggtcct
cacaaacagccatcccttcctgtcctgtatacactttccagtcaagctactcatgaagca
gttcatctcctttgcagaatgttggtcttcgatccatccaaaagaatatctgctaaggat
gccttagctcacccataccttgatgaagggcggttgcgataccacacctgtatgtgtaaa
tgctgtttttccacatccactggaagagtttatactagtgattttgaacccatcactaat
cccaaatttgatgacacttttgaaaagaacctcagttctgttcggcaggttaaagaaata
attcaccagttcattttggaacagcagaaaggaaacagagtacctctctgcatcaaccct
cagtctgctgcttttaagagctttattagttccacagttgctcaaccttctgagatgcca
ccatctccactggtttgggagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system