KEGG   Gallus gallus (chicken): 417742Help
Entry
417742            CDS       T01006                                 

Gene name
HDAC10
Definition
histone deacetylase 10
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     417742 (HDAC10)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     417742 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
1
AA seq 747 aa AA seqDB search
MASGTALIYDEAMTRHKLLWNDPICDIEVPERLSASYEQLQCYHLVERCVPVPAREGSEE
EILLVHRSEIYFHCHSFRTLGSCKSTQTMNEEELKRISGNYDSFFFHPNTYHCARLAVGA
ALQLVDSVMSGKVCNGMALVRPPGHHSQRNAANGFCLFNNVAIAAEYAKLKYGLQRILIV
DWDVHHGQGTQYIFEEDQSVLYFSWHRYEHQEFWPSLKESDYDAVGLGKGKGFNINLPWN
KVGMGNSDYLAAFFHVLLPVAFEFDPELVLVSSGYDSGIGDPEGQMNATPEVFAHLTHFL
MQLAHGKLCVILEGGYHLKSLSESVCMTVKTLLRDPLPQVTGEMAPCLSAIESIQNVRAA
HKPYWKWLTYEDTSFLHNLSTRSDLPKTADTNPCADDEAKITDSNETDKIERFLELHMKN
VIFPVPPIRTATTAELKASAHLNTFPVHLHVVKEMDKNEIEALVSDFHADLVKTNKTLLS
LGSTLTILDKILKKEVCNGIAESPAASASVAVALRHPLCFGLQRVLCIFVGDMHIIPNTE
DGKILVIHICKEEQTGKSSSKHYIVLNWKEVRCTLIDQRCVSEVNKKLFESHIMLGLGFF
LPFFFPVLPMSIFSFMFVLNCFSLLLKDADGNDFFSAVLGFILPVAYSYQPNLIVIAVGP
NRSLGISGISLLFGLLQGLAESRILAVIEDTDINLMQSVAKTLAGASVPHFGVHVPPTQE
KVNQIKMLRNQLQQDWKMLQCSVNDGI
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggaacagccctgatttacgacgaggcaatgaccaggcataagctgctttgg
aatgatcctatttgtgatattgaagtgccagaaagactgtcagcctcctatgagcagctt
cagtgttaccatcttgtggaaagatgtgtccctgtgcctgcgagagaaggaagcgaggag
gaaatcctcttagttcacaggtctgaaatttattttcattgccattcattcagaacactt
ggaagctgcaaaagcacacagacaatgaatgaagaggaactgaaaagaatctctgggaat
tatgattcttttttctttcatccgaacacttaccactgtgccaggctagctgtaggagca
gctttgcaactagtggactctgtgatgtcaggaaaagtatgcaatggaatggcattagta
agacctccaggtcaccacagtcagagaaacgcggccaatgggttctgtttgttcaacaac
gtcgctattgcagcagaatatgccaaactgaaatatggtctacagagaatcctaattgtt
gactgggatgtgcaccatgggcaaggaactcaatatatatttgaagaagatcaaagtgtt
ttgtatttttcctggcatcgctatgagcatcaggaattctggccatcgctcaaagaatct
gattatgatgctgtgggtttgggaaaaggaaaaggttttaatataaatttgccttggaat
aaggttggaatgggaaattcagattatcttgctgcattttttcatgtgttgcttccagta
gcttttgagtttgatcctgaactggttcttgtctcctctgggtatgattcaggaattgga
gaccctgagggtcagatgaatgccactcctgaagtctttgcccaccttactcatttcctg
atgcagttagctcatgggaagctatgtgtcatcctggagggtgggtaccatttgaagtcc
ttgtctgaatcagtctgcatgactgtaaaaactttgctaagagatcctctgcctcaggta
actggagaaatggcaccttgcctaagtgctattgaatctattcaaaatgtgagagcagca
cataaaccctattggaaatggttgacatatgaagacacatcatttttgcacaatttgagc
accaggtcagacttaccaaagactgctgatacaaatccctgtgcagatgatgaagctaag
ataacggacagcaacgaaactgacaaaatagaaagatttttggaattgcacatgaaaaat
gttatatttccagttcctcccatcagaacagcaacaacagctgagttgaaagcttcagcg
cacctgaacaccttcccagtacaccttcatgttgtgaaggaaatggacaaaaatgaaata
gaagctcttgtcagtgattttcatgcagaccttgtgaaaacaaacaaaactttgctctct
ctgggcagtacgttgaccatcctagataaaatacttaagaaagaggtatgcaatggaatt
gcagaatcacctgcagcttctgcttctgttgctgttgcactgagacatcctctttgtttt
gggcttcaaagagtgctttgcatctttgttggagacatgcatatcattccgaacacggaa
gatggaaaaatacttgtcatacatatttgcaaggaagaacagactggaaagagcagctct
aaacactatattgtgctaaactggaaagaggtaaggtgcaccttgatagatcagcgttgt
gtttctgaggtcaacaaaaagctttttgaatcacacattatgttgggcttggggtttttt
ttgccttttttttttccagtcctacctatgagcattttcagctttatgtttgttctaaat
tgcttttcactgctgttaaaggatgctgacgggaatgacttcttttctgctgtacttgga
ttcattcttcctgtagcatacagttaccaacccaacttgatagtaatagctgttggacca
aacaggagccttggaataagtgggatttcacttctttttggtttgctacaaggcctagca
gaatctcgaattcttgcagtgattgaggatacagacataaatctaatgcaaagtgtagcc
aaaacacttgcaggtgcttctgtgccccactttggagttcacgtgcctcctacccaagaa
aaagtaaatcaaataaaaatgttaaggaaccagcttcagcaggactggaaaatgcttcaa
tgctcagtgaacgacgggatttga

DBGET integrated database retrieval system