KEGG   Gallus gallus (chicken): 417742Help
Entry
417742            CDS       T01006                                 

Gene name
HDAC10
Definition
(RefSeq) histone deacetylase 10
  KO
K18671  
histone deacetylase 10 [EC:3.5.1.98]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     417742 (HDAC10)
Chromosome [BR:gga03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     417742 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Position
1
AA seq 680 aa AA seqDB search
MASGTALIYDEAMTSHKLLWNDPICDIEVPERLSASYEQLQCYHLVERCVPVPAREGSEE
EILLVHSSEHLEAAKSTQTMNEEELKRISGNYDSFFFHPNTYHCARLAVGAALQLVDSVM
SGKVCNGMALVRPPGHHSQRNAANGFCLFNNVAIAAEYAKLKYGLQRILIVDWDVHHGQG
TQYIFEEDPSVLYFSWHRYEHQEFWPSLKESDYDAVGLGKGKGFNINLPWNKVGMGNSDY
LAAFFHVLLPVAFEFDPELVLVSSGYDSGIGDPEGQMNATPEVFAHLTHFLMQLAHGKLC
VILEGGYHLKSLSESVCMTVKTLLRDPLPQVTGEMAPCLSAIESIQNVRAAHKPYWKWLT
YEDTSFLHNLSTRSDLPKTADTPCADDGAKITDSNETDKIERFLELHMKNVIFPVPPIRT
ATTAELEASAHLNTFPVHLHVVKEMDKNEIEALVSDFHADLVKTNKTLLSLGSTLTILDK
ILKKEVCNGIAESPAASASVAVALRHSLCFGFQRVLCIFVGDMHIIPNTEDGKILVIHIC
KEEQTGKSSSKHYIVLNWKEDADGNDFFSAVLGFILPVAYSYQPNLIVIAVGPNRSLGIS
GISLLFGLLQGLAESRILAVIEDTDINLMQSVAKTLAGASVPHFGVHVPPTQEKVNQIKM
LRNQLQQDWKMLQCSVNDGI
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggaacagccctgatttacgacgaggcaatgaccagccataagctgctttgg
aatgatcctatttgtgatattgaagtgccagaaagactgtcagcctcctatgagcagctt
cagtgttaccatcttgtggaaagatgtgtccctgtgcctgcgagagaaggaagcgaggag
gaaatcctcttagttcacagttcagaacacttggaagctgcaaaaagcacacagacaatg
aatgaagaggaactgaaaagaatctctgggaattatgattcttttttctttcatccgaac
acttaccactgtgccaggctagctgtaggagcagctttgcaactagtggactctgtgatg
tcaggaaaagtatgcaatggaatggcattagtaagacctccaggtcaccacagtcagaga
aacgcggccaatgggttctgtttgttcaacaacgtcgctattgcagcagaatatgccaaa
ctgaaatatggtctacagagaatcctaattgttgactgggatgtgcaccatgggcaagga
actcaatatatatttgaagaagatccaagtgttttgtatttttcctggcatcgctatgag
catcaggaattctggccatcgctcaaagaatctgattatgatgctgtgggtttgggaaaa
ggaaaaggttttaatataaatttgccttggaataaggttggaatgggaaattcagattat
cttgctgcattttttcatgtgttgcttccagtagcttttgagtttgatcctgaactggtt
cttgtctcctctgggtatgattcaggaattggagaccctgagggtcagatgaatgccact
cctgaagtctttgcccaccttactcatttcctgatgcagttagctcatgggaagctatgt
gtcatcctggagggtgggtaccatttgaagtccttgtctgaatcagtctgcatgactgta
aaaactttgctaagagatcctctgcctcaggtaactggagaaatggcaccttgcctaagt
gctattgaatctattcaaaatgtgagagcagcacataaaccctattggaaatggttgaca
tatgaagacacatcatttttgcacaatttgagcaccagatcagacttaccaaagactgct
gatacaccctgtgcagatgatggagctaagataacggacagcaacgaaactgacaaaata
gaaagatttttggaattgcacatgaaaaatgttatatttccagttcctcccatcagaaca
gcaacaacagctgagttggaagcttcagcgcacctgaacaccttcccagtacaccttcat
gttgtgaaggaaatggacaaaaatgaaatagaagctcttgtcagtgattttcatgcggac
cttgtgaaaacaaacaaaactttgctctctctgggcagtacgttgaccatcctagataaa
atacttaagaaagaggtatgcaatggaattgcagaatcacctgcagcttctgcttctgtt
gctgttgcactgagacattctctttgttttgggtttcaaagagtgctttgcatctttgtt
ggagacatgcatatcattccgaacacggaagatggaaaaatacttgtcatacatatttgc
aaggaagaacagactggaaagagcagctctaaacactatattgtgctaaactggaaagag
gatgctgacgggaatgacttcttttctgctgtacttggattcattcttcctgtagcatac
agttaccaacccaacttgatagtaatagctgttggaccaaacaggagccttggaataagt
gggatttcacttctttttggtttgctacaaggcctagcagaatctcgaattcttgcagtg
attgaggatacagacataaatctaatgcaaagtgtagccaaaacacttgcaggtgcttct
gtgccccactttggagttcacgtgcctcctacccaagaaaaagtaaatcaaataaaaatg
ttaaggaaccagcttcagcaggactggaaaatgcttcaatgctcagtgaacgacgggatt
tga

DBGET integrated database retrieval system