KEGG   Gallus gallus (chicken): 417896Help
Entry
417896            CDS       T01006                                 

Gene name
EEA1
Definition
early endosome antigen 1
Orthology
K12478  
early endosome antigen 1
Organism
gga  Gallus gallus (chicken)
Pathway
Endocytosis
Phagosome
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    417896 (EEA1)
   04145 Phagosome
    417896 (EEA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
1
AA seq 1450 aa AA seqDB search
MFRRILQRTPGRVGSQSSDSDLSAAPGNAVDVNNEGSSEGFICPLCMKVCVTPTDLSEHY
QNEHTGTEGRQELRDLPAVTGFICPLCMKSHGSAEELFKHYEAVHNSGIDSTRGGEGHLS
PERDEVSLLRQEVQDLQASLKEERWYSEELKKELEKLQGQRQQDSKSDGLTTSTSTESLE
RQLEEIQVENFNIKQMKDLFEQKAAQLATEIVDLKAKYDEEISLREGAEQKMTNLTQELL
KERSTIEDLKTELLQRPGVEDVAVLKKELVQVQTLMDKMTLERERESEKLKDECKHLQAE
QANSEATINQLRAELAKGPQEVAVYVQEQQKLQSLVKELEQKNQNLTEKLLKKEQEYSQL
EEKHNEISVSKKNVQASFHQKDLDCQQLQAKLSASEASVQRLQTELGEKGEASQKLKEEL
SEVETKYQHLKAECKQLQQQREEKEQHGLQLQSELSQLHSKLLETERQLGEAHGRLKEQR
QLSSEKLMDREQQVADLQLKLSRAEEQLKEKVANSTELQHQLDKAKQQHQEQQTLQQNTT
SKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISLLEKEREDLYAKIQAGEGETA
VLNQLQEKNHALQIQVTQLTEKLKNQSESHKQAQENLHEQVQEQKAHLRAAQDRVLSLEA
NITELSSQLNESKEKVSQLDVQVKAKTELLLSAEASKAAQRADLQNHLDTAQHALQDKQQ
ELNKVSVQLDQVTAKLNDKQEYCAQLEANLKDYKEQHLYLEQKTEELEGQLKKLEADVLD
AKASKEQALQELQQQRQQSTELDLRIAELSKQLEAEREAMSSAKSDLQKKSEALEQAKQQ
ISKQEEENASLKKNLEKSSQDTSKQLKDLDCKMQAATSELQQVKLEKDTLLKDLTSTKEK
LSKSSESFKKRKEELEKEIEKGKAAVAEMEKSYQEVKQQLQVQTESVAKERNELKNSLEK
KEGISKQLSIELDSTRAQVLEIQGLLKEKENSEQHLQGKLREMKESFEQKKKHSETLQTE
LKTALLEKAELENKLQQQTILSAQELKAEKGKLADLQKTHEKNKENMEKLQLDLYGKESE
LLATRQDLKSTEEKLALAQEELVSSRNRIASSNQQIQELKKAKSTLEQDASKKEQQLGEK
AKMLQDLQNERILKEKDLANEKCKTTELQEIRSRLEKESAKLSEELRICKQEFEKEVANL
KDAKQLLIQQKLELQGKIDNMNSTLEQEKKNQQAVKDQLKKREEELKKECAEIEAKLQSE
VKDKEEENRKHEEKETKLTMQVTALNENLATMKKEWQSSQRRVSELEKQTDDLRGDIAVL
EATVQNNQDERRALLERCIKSEGEIEKLQSKLVEMKKKLDNTTAAMQELGRENQSLQIKH
TQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRV
CDTCFNDLQG
NT seq 4353 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggcggatcctgcagcggactccgggcagagttgggtctcagagctcagattcc
gatttatctgccgctccaggaaatgccgtggatgtgaacaatgagggctcctctgagggc
ttcatctgtccactctgtatgaaagtgtgtgtaactcctactgatctgtctgaacattac
cagaatgagcacacggggacagaaggaagacaggagcttcgtgaccttccagctgttact
ggatttatctgtcctttgtgtatgaagtctcatggatcagctgaggagctgttcaagcac
tatgaagcagttcataattctggcatcgattcaactcgtggaggggaaggtcatctgtca
ccagaaagagatgaagtatcactgctccgacaagaagtacaagacttgcaagcttcgctg
aaggaggagagatggtattcagaagagctgaagaaagaactagagaaattgcaggggcag
cggcagcaagattctaagtctgatggattgacaacatctacatctacagaatctttagaa
cggcaactagaagagatccaagtagaaaattttaatattaagcaaatgaaagacttattt
gaacaaaaagcagcacaactggctactgaaattgtggatcttaaagcaaagtatgatgaa
gaaatcagccttcgggaaggtgcagaacagaaaatgacaaacctaacacaggaactactg
aaggagagaagtaccatagaagacttaaagacagagctgctacaaaggcctggtgtggaa
gatgtggctgttcttaaaaaggaactggtccaagttcagacactgatggacaaaatgact
ttggaacgtgagagagaatctgaaaagctgaaagatgagtgcaagcacttgcaggcagag
caggcaaactcagaggctaccattaatcagttaagagctgaacttgccaaaggacctcag
gaggtagctgtgtatgttcaggagcagcaaaaactgcaaagtttagtcaaggagctagaa
cagaaaaaccagaatctgactgagaagctgctgaagaaggagcaggagtacagccagcta
gaagaaaaacacaatgagatatctgtgagtaaaaagaatgttcaggcaagctttcaccag
aaggacctggactgccaacagcttcaggcaaagctgtctgcatcagaagcctcagtacag
agattacagacagagctaggtgagaagggagaagcaagccagaagcttaaagaagaattg
tccgaagtagagacgaagtaccagcatcttaaggcagaatgtaaacagctccagcagcag
agagaggaaaaagaacagcatggcttgcagctccagagcgagctcagtcagttgcatagt
aagcttctagaaacagagcgccagctaggggaagcacatgggcggcttaaggaacagagg
cagctctctagtgaaaagctgatggacagagagcagcaggtggctgaccttcagttgaag
ctttctcgtgctgaagaacagctaaaggaaaaagtggcaaattccacggaattgcaacat
caattagataaagcaaaacaacagcaccaagaacagcagacgcttcagcaaaacacaaca
tcaaagctacgagaagcccagaatgatttggagcaagtactacgacagattggagacaag
gaccaaaaaattcaaaatcttgaggccttgcttcaaaagagtaaggaaaatatctctctg
cttgaaaaggaaagagaggatttgtatgcgaaaattcaagctggggaaggagaaactgca
gttcttaaccagctacaagagaaaaatcacgcactgcaaatacaggtaactcagctgaca
gagaagctgaagaatcagtcagaaagtcataaacaagcccaagagaatttgcatgagcaa
gtgcaggagcagaaggcacatctaagagctgctcaagaccgtgtgctctctctggaagcc
aatatcactgagttgagcagccagctaaatgaaagtaaagagaaagtatcacaacttgat
gtacaggtaaaagcaaaaactgaattgctgctttcagcagaagcatcaaaagctgctcaa
agagcagaccttcagaatcatctggacaccgcccagcatgcactgcaagacaaacaacag
gagttaaataaggtcagcgttcagttggatcaggttacggctaagctgaatgacaagcag
gaatactgtgctcagctggaagccaatctcaaagactacaaagagcaacatctttattta
gaacagaaaaccgaagagctagagggacagcttaagaaacttgaggctgacgttcttgat
gctaaagcaagcaaagaacaagctcttcaggagttacagcagcagcgacagcaatctaca
gaattagacctccgaatagcagaactgagtaaacaacttgaagcagaaagagaagctatg
tctagtgctaaatcggatttacagaagaaatccgaggcccttgaacaagcaaaacagcaa
atttcaaagcaagaggaggaaaatgccagcctcaaaaaaaatcttgagaaatcaagtcaa
gatacaagtaaacaactcaaggatttagactgtaaaatgcaagcggcaacatcagagctt
caacaggtgaaattagagaaggatactctgttaaaggacctcacatctaccaaagagaag
ctttcaaaaagttctgaatccttcaaaaaaaggaaggaagaattagaaaaagaaatagag
aaaggaaaagcagctgtagcagaaatggaaaaatcttaccaagaagtaaaacagcagctt
caggtacagacagaatctgtagctaaagagaggaatgaattgaaaaactcactggaaaaa
aaggaggggatttctaagcagttgtcaatagaacttgactcaacacgagcacaagtactg
gaaattcagggtcttctgaaagagaaagagaacagtgagcagcatcttcagggaaagctg
agagagatgaaagaatcttttgagcagaagaaaaagcatagtgaaacgctgcaaactgaa
ttaaaaactgcacttttagaaaaggcagaacttgagaataaactgcaacagcagactatt
ctgtcagctcaggagcttaaagcagagaaaggaaaactagcagacctacagaagacccat
gaaaaaaataaggaaaacatggaaaagctgcagctggacctgtacgggaaagagtctgag
ctgctggcaaccaggcaagaccttaagtccacagaagaaaaactggctcttgctcaagaa
gaattagtttccagcagaaatcgaattgctagcagtaatcagcagattcaggaactgaag
aaagcaaagtcaacgctggaacaggatgcatcaaagaaggagcagcagctgggcgagaag
gccaaaatgttacaggatcttcagaatgagaggattttgaaagaaaaagacttggctaat
gaaaaatgtaaaacaacagagctccaggaaataaggagtagacttgaaaaagaaagtgcc
aagctgagtgaggagcttagaatctgcaagcaagaatttgagaaggaggtggcaaatctc
aaagatgcgaaacaactactgattcaacagaaattagagcttcagggcaagatagataat
atgaattcaactctggaacaggagaagaaaaaccaacaagctgtcaaagatcagctgaaa
aagagagaagaggaactgaagaaagaatgtgctgaaatcgaagccaaactgcaatcagag
gtgaaagacaaagaagaagaaaaccggaaacacgaggagaaggagaccaagctcaccatg
caggtcacagctctgaatgaaaacctggctaccatgaagaaagagtggcaaagtagtcag
agacgagttagtgaattggagaaacagactgatgatttacgtggggacattgctgtcttg
gaagcaactgtgcagaataatcaggatgagagaagagcattgctagagaggtgtataaag
agtgagggagaaattgaaaagcttcaatccaaacttgtagaaatgaagaagaagctggac
aatactaccgctgcaatgcaggagctaggccgggaaaaccagtcgttacagatcaaacac
acccaagctctcaacaggaaatgggcagaagacaatgaggtacagaattgtatggcctgt
ggaaaaggcttttcagtgactgtgagaaggcatcactgtagacagtgtggaaatatcttt
tgtgctgagtgctcagcaaagaatgccttaactccttcttctaagaagcctgtccgggtc
tgtgatacttgctttaatgacttgcaaggataa

DBGET integrated database retrieval system