KEGG   Gallus gallus (chicken): 417913Help
Entry
417913            CDS       T01006                                 

Gene name
USP44
Definition
ubiquitin specific peptidase 44
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     417913 (USP44)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   417913 (USP44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 714 aa AA seqDB search
MDKCKHIGRLRLAQDHSILNPQKWHCVDCNTTESVWACLSCSHVACGRYIEEHALKHFQE
NGHPVALEVNELYVFCYLCDDYVLNDNATGDIKLLRSTLSAIKSQKYECTTRSGRTLRSM
GASDDSYLSHDGAQALLRNQDRMFTALWHRRRAFMGKIFRSWFQLTPSGKKILEEEKRLE
EEEERRNKARKRRQERKRQLKEEMEKMPPRKSCRLQNQMRMSSQTASVTQKTSQSTESVS
ELKETYTSDEVRLKKIGDSPIKRRPTVTPGVTGLRNLGNTCYMNSILQVLSHLLIFRECF
LKLDLNQTQELLATAASGKTRSSSRRSSVTASTLQANENQEKGRGSSSVRRSNLSSGLSG
GASKSRNMELIQPREPSSKHISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRG
YAQQDAQEFLCELLDKVQQELETTGTRYPALIPAAQRKLIKQVLNVVNNIFHGQLLSQVT
CLACDNKSNTIEPFWDLSLEFPERYHCNGKEMASQYPCPLTEMLAKFTETEALEGKIYAC
DQCNTKRRKFSSKPVILTEAQKQLMVCRLPQVLRLHLKRFRWSGRNHREKIGVHVNFDQI
LNMEPYCCRESLKSLLPDCFIYDLSAVVMHHGKGFGSGHYTAYCYNSEGGFWVHCNDSKL
NMCTMEEVCKAQAYILFYSQRLSQANGLGKICPSTSESQQHTELADCSVDNSSS
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggataagtgtaagcacataggacgcctgcgactggcccaagatcactccattctgaat
ccacagaaatggcattgcgtggactgcaatactaccgagtcagtgtgggcatgcctcagc
tgctcgcacgtggcgtgtgggagatacattgaagaacatgcactaaagcactttcaggag
aacggtcacccggtggcgttggaagtaaacgagctgtatgttttctgttatctctgtgat
gattatgttcttaatgataatgcaactggtgatataaaactgttgcgaagtacattaagt
gcaatcaagagtcaaaagtatgagtgtactactcgtagcgggaggactttgcgttccatg
ggtgccagcgatgattcctacctttcacacgatggtgcccaggccttgcttcgcaatcaa
gaccgcatgttcacagcactgtggcacagaaggcgcgcgttcatgggcaaaatattcagg
tcgtggttccagctgacacctagcggaaaaaagattttggaagaagagaagcgtttggaa
gaagaggaggaaaggaggaacaaagctagaaagagaaggcaggaacgaaagcgccagttg
aaggaagagatggaaaagatgcctccaagaaagagttgccgtttacaaaaccagatgaga
atgtcctcacaaactgcatccgtcacgcaaaagacatcacagagcacggaatccgtgtcg
gagttgaaagaaacgtatacctcagatgaagtaagattgaaaaagataggtgactctcca
attaaacgaaggcccaccgtgactccaggggtaacaggactgaggaacctgggaaacacg
tgctatatgaattctatcctgcaggtattaagtcacttacttatttttcgagaatgcttc
ttaaagctggatctcaaccaaactcaggaactgctggcaacagcggccagtggtaaaacc
aggtcttcatccaggcgctcgtcagtaactgcttcaacattacaggcgaatgagaaccaa
gagaaaggaaggggatcatcttctgtgagacgatctaatttatcctctggattaagtgga
ggagcatcaaaaagtagaaatatggaactcattcagcccagggagcccagttcaaagcat
atttctctttgtcacgagctgcatactctgtttcaagtgatgtggtctggcaaatgggcg
ctggtgtctccttttgccatgcttcattctgtctggagactaattccagccttcagagga
tatgcccaacaagatgctcaggaattcctttgtgaacttttggataaagtgcagcaggaa
ctggagactacggggaccagatacccagctctcatccctgctgctcaaagaaaacttata
aaacaggttttgaatgtggtgaacaacatttttcatggacagctattaagtcaggttaca
tgccttgcctgtgacaataaatcaaacaccatagaacctttctgggacctgtcactggag
ttccccgagaggtatcactgcaatggcaaggagatggcatcgcagtatccctgcccgctg
actgaaatgctggccaagtttacagaaactgaagctttggaaggaaagatatatgcgtgt
gatcagtgcaacacaaaacgcaggaagttttcttctaaaccagttatactcacagaagct
cagaagcagcttatggtgtgtcgactacctcaggttctccgattacacctgaagaggttt
aggtggtcaggacgcaatcatcgtgaaaagatcggcgtgcatgttaattttgatcaaata
ctgaacatggagccttactgctgcagagaatccctcaagtctctcctaccagactgcttt
atctacgacttgtctgctgtagtaatgcatcatgggaaaggatttggctcagggcactac
actgcctactgctacaattcagaaggaggattttgggtacactgcaatgattcaaaactc
aacatgtgcactatggaagaagtatgcaaggctcaagcctacattttgttttacagccaa
cgactttctcaggcaaacggacttggtaaaatatgtcctagcacatctgaaagtcagcag
cacacagagttagctgactgttctgtggacaacagtagcagctaa

DBGET integrated database retrieval system