KEGG   Gallus gallus (chicken): 417935Help
Entry
417935            CDS       T01006                                 

Gene name
NUP205
Definition
(RefSeq) nucleoporin 205
  KO
K14310  nuclear pore complex protein Nup205
Organism
gga  Gallus gallus (chicken)
Pathway
gga03013  RNA transport
Module
gga_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    417935 (NUP205)
Messenger RNA biogenesis [BR:gga03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     417935 (NUP205)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    417935 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nup192
Motif
Other DBs
NCBI-GeneID: 417935
NCBI-ProteinID: XP_416176
CGNC: 8864
Ensembl: ENSGALG00000011662
UniProt: E1BV83
Position
1
AA seq 2014 aa AA seqDB search
MAAPLAVNSAASLWGPYKDIWQTVMNAIWKRQPEAIHRLDQVLKKHRSDFISLFRNPPKN
VQQHEKVQKASTEGVAIQGQQGTRLLPEQLIREAFILSDLFDIGELAAVELLLAGEHQQP
HFPGLTRGLVAVLLYWDGKRCIANSLRTLIQSRQGKTWTLELSQELVSMTTRFTDDLMEQ
GLTQKILTLVSQIDLNNEFDKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFVWTCQSP
LSKDDTLILISYLEKVTVEADGSLDSVNLSLLMALLYCFDVSFLEQGTEDREDLMHRLPL
LAERQYIATIHTRLQESQPWKLPGLQATVRLAWALALRGISQLSDVTALAEFTEADEAMA
ELAVADNVFLFLTESVVGSENFYQEEFYIRKIHNLVTDFLALMPMKVKQLRNRADEDARM
IHMSIQMGNDPPISLRRDLEHLMLLIAELYRKDPFNLELALEYWCPSEPLQTSTIMGSYL
GVAHQRPPQRQVVLSKFVRQMGDLLPSTIYIPYLKMLRGLASGPQCAHYCFSLLKVNGSS
HAENIQGAGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPLRGITQKEQDGLIAF
LQLTTVIVNWSENARLALCEHPQWTPVVVILGLLQCSIPPVLKAELLETLTAFGKSPEIA
ASLWQSLEYTQILQTVRTPGQRQAIGIEVELNEIESRCEEYPLTRAFCRLISTLVESSFP
SNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQL
EDFVDQYVELQGDEIIAYKPPGFNLMYHLLNESPMLELSLSLLEEGVKQLDTYAPFPGKK
HLEKAVEHCLALLNLTLQKENLFMDLLRESHLSLIVTPLEQLLQGINPRTKKADHVVNIA
RYLYHGNSNPELAFESAKILCCISCNSNIQIKLVGDFTHDQSTSQKLMAGFVECLDNEDA
EELINPDEELEPEKKRARIHHETRIHILNLLITSLECSPPSLALYLLGYELKKPVSTTNL
QDPGVLGCPRTCLHAILNILEKGTETRNGPTAVQESPHLAELCYQVIYQLCACSETSGPT
MRYLRTSQDFLFTQLQYLPFSIREHEISTLNQMSWLMKTAAIEMRVTSLNRQRSHTQRLL
HLLLDDMPVKPYLADGEGGMEDESRSVSGFLHFDTASKVRRKILSILDSIDFSQDIPEPL
QLDFFDRVQIEQVIANCEHKNARGQVVCNVKHLHRVLVAEVNALQGMAAIGQRPLLMEEI
NTILQYVVERNKLLQCLHAKKHALESWRQLVEIILTACPQDLIQAEDRQLIIRDLLQDVH
DKILDDDAAQELMPVVAGAVFTLTAHLSQSVKTEQKQPLAVPMTGQSQYVLMLDGSFTSS
PGSESISMGFASIGDSSLHIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEP
DTLEAAKKTMWERLTAPEDVFSKLQRENMAIIESYGAALMEVVCRDACDGHEIGRMLALA
LLDRIVSVDKQQQWLLYLSNSGYLKVLVDSLVDDDLTLQSLLMPQPPLLKALYTYESKMA
FLTRVAKSQQGALELLRSGVIVRLAQCQVYDMRPETDHQGMYGMRDPPVFIPAPVERYRQ
ILLPALQLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQAILRCQDVSVGSLQELASLTG
IISKAALPGVLNELDVDVNEGTQMELQGHIGRFQRQCLGLLSRFGGSDRLRQFKLQDDNA
EGDRVNKRDEIELAMQQICANVMEYCESLMLQSAPSFEHTVCLFTPSLSESTNRDGPRQD
TQAPVVPYWRLPGLGIIIYLLKQSTNDFFSYYDSHRQSVNKLQNVEQLPPDEIKELCQSV
MPAGVDKISTAQKYVLARRRLVKLINNRAKLLSLCSYIIETCLFILWRHLEHYLLNYTPT
DSQDSLLSSRISFKRGRLQDSFGSESSLDFSSGLNRVSQHDIDQLQIETTNSFGESLQKK
LLDIEGLYSKVRSRYTFIQALVRRIRGLLRISRT
NT seq 6045 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccgttggcggtaaattcggctgccagcttgtggggtccgtataaggacata
tggcagactgtaatgaatgccatttggaaaaggcaacctgaagctattcatcgcctcgac
caggtcttaaagaaacacagatctgacttcatttctctcttcagaaatccgccaaagaat
gttcagcagcatgagaaagttcagaaagcaagtacagaaggggttgctatccaaggtcag
cagggaaccaggcttttgccagaacaactcatcagagaagcctttatcctcagtgacctc
tttgatatcggagagttggcagctgttgagcttcttctagctggagaacaccagcaacct
cattttcctggccttacaagaggtcttgtggctgtgctgttgtactgggatggaaaaaga
tgcatagccaattcactacgaactctcatccagtcacgccaaggcaagacttggacactg
gaactcagtcaagagctagtgtccatgacaacacgctttacagatgacctaatggagcag
ggtttgactcagaaaatcctcacactcgtgtctcaaattgatttaaacaatgaatttgat
aaactccagagagagcgaggattgggcagcgagaaacatcgcaaagaggtttctgacctc
atcaaagagtgccgacagtccttggctgaaagtctctttgtctggacctgccagtcacca
ctgagtaaggatgacactctaatcctcataagttacttggagaaagtaacagtagaagct
gatggctcattggacagtgtcaacttgtctctactcatggcactcctctactgctttgat
gtcagctttctggaacaaggcacagaggaccgtgaagatctgatgcaccggctccctcta
ctagcagaaagacagtacatagcaacaatacacactcgtcttcaagagtctcagccctgg
aaactaccaggcctacaagcaactgttagattagcctgggcactggcgttacgaggaata
tcccaattatctgatgtgacagctctcgcagagttcaccgaggcagatgaagcaatggca
gagctggcggttgctgataacgtctttctgttcctgacggaatctgttgtgggatctgaa
aatttctaccaggaggagttttacattcgcaagattcataaccttgtcacagacttcctt
gcgctcatgccaatgaaagtgaagcagctgagaaaccgtgccgatgaggacgctcgcatg
atccacatgagtattcagatgggaaacgatccacctatttctcttcgcagagatctggag
cacttaatgcttttaattgctgaattgtataggaaagacccctttaatttggaacttgcc
cttgaatactggtgtccatcagagcctttgcagacatctaccatcatggggtcatatctt
ggagtagctcatcagcgacctcctcagcgccaggttgtcttgtcaaagtttgttaggcaa
atgggagatctgcttccctccacaatttacatcccatacttgaaaatgctgcggggattg
gccagtgggcctcagtgtgctcattactgctttagtttgctaaaagtcaatggcagtagt
cacgcggaaaacatccaaggagcaggtggcagccctgtctcctgggagcattttttccat
tctttgatgctttatcatgaacacttaaggaaagacttgccaagcgctgacagcgttcag
tatcgtcacctgcctctccgaggaatcacacagaaagagcaggatgggttaattgccttt
ttgcagctgaccactgttatagtgaattggagtgagaatgctcgcttggctctttgtgag
caccctcagtggacgccagtggtggtcattctgggacttctgcagtgcagcattcctcct
gttttgaaagctgagctgttagaaactcttactgcttttgggaaatctcctgaaatagct
gcttcactttggcaatctctggaatacactcagatattacaaactgtgagaactccaggc
cagagacaagcgattgggattgaggttgaactgaatgagattgaatccagatgtgaggag
tatcctttaacccgtgccttctgtcgactcatcagcacactcgtggagagttcattcccc
tcaaacttgggggcaggtctccgcccgccaggctttgatccctatctccagttcctgagg
gactccgtgtttcttcgatttcgcaccagagcttaccgaagagctgctgaaaaatgggaa
gtggctgaggtagtattagaggtattttacaaattgttgcgggactacgaacctcagctt
gaagacttcgtggatcagtatgtggagttacaaggagatgaaataatagcatacaaacca
cctggattcaatttgatgtatcatctattgaatgagtccccaatgttggaactgtctctg
agtttgctggaggaaggagtaaagcagctggatacttatgccccatttcctgggaagaag
catttagagaaagcagtagagcattgccttgcacttctaaacttaaccctacagaaagag
aatctttttatggatctgttacgggaaagccatctctccctaattgtcacaccattggag
cagctgcttcagggcatcaatccccgcaccaaaaaggccgatcatgtggtgaatatcgct
aggtatctttatcatggaaacagcaatcctgaactggcttttgaaagtgccaagattttg
tgctgcatttcttgtaattccaacatccagataaagcttgttggtgatttcacacatgat
cagagtactagtcagaagctgatggccgggtttgtggagtgtttggacaatgaggatgca
gaagaattaattaatccagatgaagagttggagcctgaaaagaagcgggcgcgaatccat
catgaaacaaggatccatattctgaatctcctcatcacgtctcttgagtgtagtccgccc
agccttgctctgtatctcttgggatatgaactaaagaaacctgtcagcaccacaaatctg
caagacccaggtgtcctgggttgtccacggacttgccttcatgctattttgaacatactg
gagaaaggcactgaaacaagaaatgggcctacagcagttcaggaatctcctcatcttgca
gaactctgttaccaggtgatctatcagttatgtgcatgctctgaaacatcgggtccaact
atgcgatacctgaggaccagtcaggatttcttattcactcagctgcagtatttgccattt
tctataagagaacatgagatttcaacactgaaccagatgtcatggttgatgaaaactgca
gctatagaaatgcgagtgacatcacttaaccgccagcgctcccatacacagaggctgctg
catctgctgcttgatgacatgcctgtgaaaccatacttggctgatggtgaaggagggatg
gaagatgaaagtcgatccgtcagtggttttctccattttgacactgcctccaaagtacgc
aggaaaatcttaagtatcttggattcaattgacttcagtcaggacattccagagcctttg
caactggatttttttgaccgtgttcagattgagcaagtcattgctaactgtgaacacaag
aatgcacgcgggcaagtggtctgcaatgtcaagcatcttcacagagttctggtcgcagaa
gtcaatgccctgcaaggaatggcagcaataggtcagagacctttacttatggaggagatc
aacaccatcctgcaatacgtagtggaacggaataaactgctgcaatgcctccatgctaag
aagcatgctttagagtcatggaggcagctggtggaaatcatactcactgcctgcccccag
gatcttatacaggctgaagacagacaattgataatccgtgatctattacaagatgttcat
gacaagatcctagatgatgacgcagctcaggagctgatgccagtggtggcaggggctgtg
tttaccctcactgcccatctgagccagtctgtgaaaacagagcagaaacagccacttgca
gtcccaatgactggacagtcccaatacgtcttgatgctggatggctcttttacctcatca
cctggctctgagagcatatccatgggttttgcttccattggtgattcttcactccacatc
atcttaaaaaagctgctggatttcattttgaaaacaggtggtggattccagagagtgagg
acacacctttacggttcactgctttattatttacagattgcacagagaccggatgaacca
gacactttagaagctgctaaaaaaacaatgtgggaacgtctgacagctcctgaagatgtg
tttagtaaattgcaacgagaaaacatggcaattattgagagttatggggcagctctcatg
gaggtggtctgtcgtgatgcttgtgatggccatgagataggcaggatgttggcattggct
ttgcttgatcgcattgtttcagtagacaagcagcagcagtggcttttgtatctctctaat
agtggctacctgaaggtgcttgtggatagcttagtagatgatgatctcactcttcagagc
ttactcatgcctcagccacctttacttaaggcgttgtacacctatgaatccaaaatggca
ttcctcaccagggtagctaaaagtcagcaaggggcgttagaactgttgcggtctggtgta
attgtgaggctggcacagtgtcaagtgtatgatatgcgacccgaaacagaccatcaggga
atgtatggaatgagagatcccccagtcttcattcctgctccagtggaacgttatcgccag
attcttcttccagctcttcagctgtgccaagtgatcctcacatccagcatggcgcagcac
ctgcaagcagcgggacaggttttgcagtttctcatttcccattcagatactatccaggca
atcctgaggtgtcaagatgttagtgttggatctctccaagagctggcctccctgacagga
ataatcagcaaggcagctttgcctggagtgctaaatgaattggatgttgatgttaatgaa
gggacacagatggagctacaaggacatataggtcgatttcagcgccagtgcttaggactt
ctaagtcgatttggtggttcagacaggctacgtcagtttaaactgcaggatgataatgca
gaaggagacagagtgaacaagagagatgaaattgagttggccatgcaacagatctgtgca
aatgtgatggagtactgtgagtcgcttatgttgcaaagtgcccccagttttgagcatact
gtttgcctgttcactcctagcctgtcagagtcaaccaaccgagatgggcctcgtcaagat
acacaagcaccagtggtcccatactggcgcttgcctggtttgggcattatcatctaccta
ctgaaacagagcactaatgatttcttcagttactatgatagccatcgtcagagtgttaac
aaactgcaaaatgtggagcaactcccaccagatgaaataaaagagctgtgtcaatcagtt
atgccagctggggttgataaaatctccactgcccaaaaatatgttttggcaaggcgacgt
ctggtgaagctaataaacaaccgagccaagctgctttctctttgttcttatattatagaa
acgtgtctcttcattctttggcgtcatctggaacactatctactgaattacacacccact
gactcccaagactcactgctatcttccagaatatcatttaagagaggaagactgcaagat
tcctttggttcagagtccagcttggatttcagcagtggactgaatcgagtgagtcagcat
gatatagatcagcttcagattgaaaccaccaacagttttggtgaatccctacagaagaag
cttctggacattgaggggttatattctaaggttcggtcacgttacacctttattcaagct
ctcgtaagacgtatccgtggtctcctaaggatatcaaggacctaa

DBGET integrated database retrieval system