KEGG   Gallus gallus (chicken): 417935Help
Entry
417935            CDS       T01006                                 

Gene name
NUP205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
gga  Gallus gallus (chicken)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    417935 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 2014 aa AA seqDB search
MAAPLAVNSAASLWGPYKDIWQTVMNAIWKRQPEAIHRLDQVLKKHRSDFISLFRNPPKN
VQQHEKVQKASTEGVAIQGQQGTRLLPEQLIREAFILSDLFDIGELAAVELLLAGEHQQP
HFPGLTRGLVAVLLYWDGKRCIANSLRTLIQSRQGKTWTLELSQELVSMTTRFTDDLMEQ
GLTQKILTLVSQIDLNNEFDKLQRERGLGSEKHRKEVSDLIKECRQSLAESLFVWTCQSP
LSKDDTLILISYLEKVTVEADGSLDSVNLSLLMALLYCFDVSFLEQGTEDREDLMHRLPL
LAERQYIATIHTRLQESQPWKLPGLQATVRLAWALALRGISQLSDVTALAEFTEADEAMA
ELAVADNVFLFLTESVVGSENFYQEEFYIRKIHNLVTDFLALMPMKVKQLRNRADEDARM
IHMSIQMGNDPPISLRRDLEHLMLLIAELYRKDPFNLELALEYWCPSEPLQTSTIMGSYL
GVAHQRPPQRQVVLSKFVRQMGDLLPSTIYIPYLKMLRGLASGPQCAHYCFSLLKVNGSS
HAENIQGAGGSPVSWEHFFHSLMLYHEHLRKDLPSADSVQYRHLPLRGITQKEQDGLIAF
LQLTTVIVNWSENARLALCEHPQWTPVVVILGLLQCSIPPVLKAELLETLTAFGKSPEIA
ASLWQSLEYTQILQTVRTPGQRQAIGIEVELNEIESRCEEYPLTRAFCRLISTLVESSFP
SNLGAGLRPPGFDPYLQFLRDSVFLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQL
EDFVDQYVELQGDEIIAYKPPGFNLMYHLLNESPMLELSLSLLEEGVKQLDTYAPFPGKK
HLEKAVEHCLALLNLTLQKENLFMDLLRESHLSLIVTPLEQLLQGINPRTKKADHVVNIA
RYLYHGNSNPELAFESAKILCCISCNSNIQIKLVGDFTHDQSTSQKLMAGFVECLDNEDA
EELINPDEELEPEKKRARIHHETRIHILNLLITSLECSPPSLALYLLGYELKKPVSTTNL
QDPGVLGCPRTCLHAILNILEKGTETRNGPTAVQESPHLAELCYQVIYQLCACSETSGPT
MRYLRTSQDFLFTQLQYLPFSIREHEISTLNQMSWLMKTAAIEMRVTSLNRQRSHTQRLL
HLLLDDMPVKPYLADGEGGMEDESRSVSGFLHFDTASKVRRKILSILDSIDFSQDIPEPL
QLDFFDRVQIEQVIANCEHKNARGQVVCNVKHLHRVLVAEVNALQGMAAIGQRPLLMEEI
NTILQYVVERNKLLQCLHAKKHALESWRQLVEIILTACPQDLIQAEDRQLIIRDLLQDVH
DKILDDDAAQELMPVVAGAVFTLTAHLSQSVKTEQKQPLAVPMTGQSQYVLMLDGSFTSS
PGSESISMGFASIGDSSLHIILKKLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEP
DTLEAAKKTMWERLTAPEDVFSKLQRENMAIIESYGAALMEVVCRDACDGHEIGRMLALA
LLDRIVSVDKQQQWLLYLSNSGYLKVLVDSLVDDDLTLQSLLMPQPPLLKALYTYESKMA
FLTRVAKSQQGALELLRSGVIVRLAQCQVYDMRPETDHQGMYGMRDPPVFIPAPVERYRQ
ILLPALQLCQVILTSSMAQHLQAAGQVLQFLISHSDTIQAILRCQDVSVGSLQELASLTG
IISKAALPGVLNELDVDVNEGTQMELQGHIGRFQRQCLGLLSRFGGSDRLRQFKLQDDNA
EGDRVNKRDEIELAMQQICANVMEYCESLMLQSAPSFEHTVCLFTPSLSESTNRDGPRQD
TQAPVVPYWRLPGLGIIIYLLKQSTNDFFSYYDSHRQSVNKLQNVEQLPPDEIKELCQSV
MPAGVDKISTAQKYVLARRRLVKLINNRAKLLSLCSYIIETCLFILWRHLEHYLLNYTPT
DSQDSLLSSRISFKRGRLQDSFGSESSLDFSSGLNRVSQHDIDQLQIETTNSFGESLQKK
LLDIEGLYSKVRSRYTFIQALVRRIRGLLRISRT
NT seq 6045 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccgttggcggtaaattcggctgccagcttgtggggtccgtataaggacata
tggcagactgtaatgaatgccatttggaaaaggcaacctgaagctattcatcgcctcgac
caggtcttaaagaaacacagatctgacttcatttctctcttcagaaatccgccaaagaat
gttcagcagcatgagaaagttcagaaagcaagtacagaaggggttgctatccaaggtcag
cagggaaccaggcttttgccagaacaactcatcagagaagcctttatcctcagtgacctc
tttgatatcggagagttggcagctgttgagcttcttctagctggagaacaccagcaacct
cattttcctggccttacaagaggtcttgtggctgtgctgttgtactgggatggaaaaaga
tgcatagccaattcactacgaactctcatccagtcacgccaaggcaagacttggacactg
gaactcagtcaagagctagtgtccatgacaacacgctttacagatgacctaatggagcag
ggtttgactcagaaaatcctcacactcgtgtctcaaattgatttaaacaatgaatttgat
aaactccagagagagcgaggattgggcagcgagaaacatcgcaaagaggtttctgacctc
atcaaagagtgccgacagtccttggctgaaagtctctttgtctggacctgccagtcacca
ctgagtaaggatgacactctaatcctcataagttacttggagaaagtaacagtagaagct
gatggctcattggacagtgtcaacttgtctctactcatggcactcctctactgctttgat
gtcagctttctggaacaaggcacagaggaccgtgaagatctgatgcaccggctccctcta
ctagcagaaagacagtacatagcaacaatacacactcgtcttcaagagtctcagccctgg
aaactaccaggcctacaagcaactgttagattagcctgggcactggcgttacgaggaata
tcccaattatctgatgtgacagctctcgcagagttcaccgaggcagatgaagcaatggca
gagctggcggttgctgataacgtctttctgttcctgacggaatctgttgtgggatctgaa
aatttctaccaggaggagttttacattcgcaagattcataaccttgtcacagacttcctt
gcgctcatgccaatgaaagtgaagcagctgagaaaccgtgccgatgaggacgctcgcatg
atccacatgagtattcagatgggaaacgatccacctatttctcttcgcagagatctggag
cacttaatgcttttaattgctgaattgtataggaaagacccctttaatttggaacttgcc
cttgaatactggtgtccatcagagcctttgcagacatctaccatcatggggtcatatctt
ggagtagctcatcagcgacctcctcagcgccaggttgtcttgtcaaagtttgttaggcaa
atgggagatctgcttccctccacaatttacatcccatacttgaaaatgctgcggggattg
gccagtgggcctcagtgtgctcattactgctttagtttgctaaaagtcaatggcagtagt
cacgcggaaaacatccaaggagcaggtggcagccctgtctcctgggagcattttttccat
tctttgatgctttatcatgaacacttaaggaaagacttgccaagcgctgacagcgttcag
tatcgtcacctgcctctccgaggaatcacacagaaagagcaggatgggttaattgccttt
ttgcagctgaccactgttatagtgaattggagtgagaatgctcgcttggctctttgtgag
caccctcagtggacgccagtggtggtcattctgggacttctgcagtgcagcattcctcct
gttttgaaagctgagctgttagaaactcttactgcttttgggaaatctcctgaaatagct
gcttcactttggcaatctctggaatacactcagatattacaaactgtgagaactccaggc
cagagacaagcgattgggattgaggttgaactgaatgagattgaatccagatgtgaggag
tatcctttaacccgtgccttctgtcgactcatcagcacactcgtggagagttcattcccc
tcaaacttgggggcaggtctccgcccgccaggctttgatccctatctccagttcctgagg
gactccgtgtttcttcgatttcgcaccagagcttaccgaagagctgctgaaaaatgggaa
gtggctgaggtagtattagaggtattttacaaattgttgcgggactacgaacctcagctt
gaagacttcgtggatcagtatgtggagttacaaggagatgaaataatagcatacaaacca
cctggattcaatttgatgtatcatctattgaatgagtccccaatgttggaactgtctctg
agtttgctggaggaaggagtaaagcagctggatacttatgccccatttcctgggaagaag
catttagagaaagcagtagagcattgccttgcacttctaaacttaaccctacagaaagag
aatctttttatggatctgttacgggaaagccatctctccctaattgtcacaccattggag
cagctgcttcagggcatcaatccccgcaccaaaaaggccgatcatgtggtgaatatcgct
aggtatctttatcatggaaacagcaatcctgaactggcttttgaaagtgccaagattttg
tgctgcatttcttgtaattccaacatccagataaagcttgttggtgatttcacacatgat
cagagtactagtcagaagctgatggccgggtttgtggagtgtttggacaatgaggatgca
gaagaattaattaatccagatgaagagttggagcctgaaaagaagcgggcgcgaatccat
catgaaacaaggatccatattctgaatctcctcatcacgtctcttgagtgtagtccgccc
agccttgctctgtatctcttgggatatgaactaaagaaacctgtcagcaccacaaatctg
caagacccaggtgtcctgggttgtccacggacttgccttcatgctattttgaacatactg
gagaaaggcactgaaacaagaaatgggcctacagcagttcaggaatctcctcatcttgca
gaactctgttaccaggtgatctatcagttatgtgcatgctctgaaacatcgggtccaact
atgcgatacctgaggaccagtcaggatttcttattcactcagctgcagtatttgccattt
tctataagagaacatgagatttcaacactgaaccagatgtcatggttgatgaaaactgca
gctatagaaatgcgagtgacatcacttaaccgccagcgctcccatacacagaggctgctg
catctgctgcttgatgacatgcctgtgaaaccatacttggctgatggtgaaggagggatg
gaagatgaaagtcgatccgtcagtggttttctccattttgacactgcctccaaagtacgc
aggaaaatcttaagtatcttggattcaattgacttcagtcaggacattccagagcctttg
caactggatttttttgaccgtgttcagattgagcaagtcattgctaactgtgaacacaag
aatgcacgcgggcaagtggtctgcaatgtcaagcatcttcacagagttctggtcgcagaa
gtcaatgccctgcaaggaatggcagcaataggtcagagacctttacttatggaggagatc
aacaccatcctgcaatacgtagtggaacggaataaactgctgcaatgcctccatgctaag
aagcatgctttagagtcatggaggcagctggtggaaatcatactcactgcctgcccccag
gatcttatacaggctgaagacagacaattgataatccgtgatctattacaagatgttcat
gacaagatcctagatgatgacgcagctcaggagctgatgccagtggtggcaggggctgtg
tttaccctcactgcccatctgagccagtctgtgaaaacagagcagaaacagccacttgca
gtcccaatgactggacagtcccaatacgtcttgatgctggatggctcttttacctcatca
cctggctctgagagcatatccatgggttttgcttccattggtgattcttcactccacatc
atcttaaaaaagctgctggatttcattttgaaaacaggtggtggattccagagagtgagg
acacacctttacggttcactgctttattatttacagattgcacagagaccggatgaacca
gacactttagaagctgctaaaaaaacaatgtgggaacgtctgacagctcctgaagatgtg
tttagtaaattgcaacgagaaaacatggcaattattgagagttatggggcagctctcatg
gaggtggtctgtcgtgatgcttgtgatggccatgagataggcaggatgttggcattggct
ttgcttgatcgcattgtttcagtagacaagcagcagcagtggcttttgtatctctctaat
agtggctacctgaaggtgcttgtggatagcttagtagatgatgatctcactcttcagagc
ttactcatgcctcagccacctttacttaaggcgttgtacacctatgaatccaaaatggca
ttcctcaccagggtagctaaaagtcagcaaggggcgttagaactgttgcggtctggtgta
attgtgaggctggcacagtgtcaagtgtatgatatgcgacccgaaacagaccatcaggga
atgtatggaatgagagatcccccagtcttcattcctgctccagtggaacgttatcgccag
attcttcttccagctcttcagctgtgccaagtgatcctcacatccagcatggcgcagcac
ctgcaagcagcgggacaggttttgcagtttctcatttcccattcagatactatccaggca
atcctgaggtgtcaagatgttagtgttggatctctccaagagctggcctccctgacagga
ataatcagcaaggcagctttgcctggagtgctaaatgaattggatgttgatgttaatgaa
gggacacagatggagctacaaggacatataggtcgatttcagcgccagtgcttaggactt
ctaagtcgatttggtggttcagacaggctacgtcagtttaaactgcaggatgataatgca
gaaggagacagagtgaacaagagagatgaaattgagttggccatgcaacagatctgtgca
aatgtgatggagtactgtgagtcgcttatgttgcaaagtgcccccagttttgagcatact
gtttgcctgttcactcctagcctgtcagagtcaaccaaccgagatgggcctcgtcaagat
acacaagcaccagtggtcccatactggcgcttgcctggtttgggcattatcatctaccta
ctgaaacagagcactaatgatttcttcagttactatgatagccatcgtcagagtgttaac
aaactgcaaaatgtggagcaactcccaccagatgaaataaaagagctgtgtcaatcagtt
atgccagctggggttgataaaatctccactgcccaaaaatatgttttggcaaggcgacgt
ctggtgaagctaataaacaaccgagccaagctgctttctctttgttcttatattatagaa
acgtgtctcttcattctttggcgtcatctggaacactatctactgaattacacacccact
gactcccaagactcactgctatcttccagaatatcatttaagagaggaagactgcaagat
tcctttggttcagagtccagcttggatttcagcagtggactgaatcgagtgagtcagcat
gatatagatcagcttcagattgaaaccaccaacagttttggtgaatccctacagaagaag
cttctggacattgaggggttatattctaaggttcggtcacgttacacctttattcaagct
ctcgtaagacgtatccgtggtctcctaaggatatcaaggacctaa

DBGET integrated database retrieval system