KEGG   Gallus gallus (chicken): 417957Help
Entry
417957            CDS       T01006                                 

Gene name
HIST1H2B5, H2B-V, HIST1H2BN
Definition
histone cluster 1, H2B-V (similar to human histone cluster 1, class H2B)
Orthology
K11252  
histone H2B
Organism
gga  Gallus gallus (chicken)
Brite
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   417957 (HIST1H2B5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKTQKKGDKKRRKSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagccggccaagtccgcgcccgccccgaagaagggctctaagaaggcggtcacc
aagacccagaagaagggtgataagaaaagacgaaagagccgcaaggagagctactcgatc
tacgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcgtccaaggccatg
ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccggcgaggcgtcgcgc
ctggcgcactacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgg
ctgctgctgcccggcgagctggccaagcacgcggtctccgagggcaccaaggcggtcacc
aagtacaccagctccaagtag

DBGET integrated database retrieval system